SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147671432|ref|YP_001215035.1| from Vibrio cholerae O395

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147671432|ref|YP_001215035.1|
Domain Number 1 Region: 22-187
Classification Level Classification E-value
Superfamily MtlR-like 7.06e-59
Family MtlR-like 0.000000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147671432|ref|YP_001215035.1|
Sequence length 193
Comment mannitol repressor protein [Vibrio cholerae O395]
Sequence
MSRAVTRSRLNSTTDQFMAEKINESDILERLNQTHTVRGFFITTVDVLTEAIDALMQRIF
RKDNFAVKSVVEPLLHDTGPLGDLTVRLKLLFGLGVIPDEVFHDIEHLIKLRNQLNHDAT
EYQFTDPQILAPIKALNLVKKMGMLHLNVVEPDDDIDLSFYHLQLQRQQQVIKSGLSLAI
IQICNALNKDSPF
Download sequence
Identical sequences A0A0H3ACI9 A0A0H3Q657 A0A0X1L1F0 A0A1V9PUV0 A0A220TDH5 C3LWV9 Q9KKQ5
gi|15601798|ref|NP_233429.1| gi|229605353|ref|YP_002876057.1| APC85353 NP_233429.1.72393 WP_001882831.1.100264 WP_001882831.1.100388 WP_001882831.1.100440 WP_001882831.1.10071 WP_001882831.1.100976 WP_001882831.1.101117 WP_001882831.1.10121 WP_001882831.1.101220 WP_001882831.1.101314 WP_001882831.1.101507 WP_001882831.1.101933 WP_001882831.1.102054 WP_001882831.1.1024 WP_001882831.1.10626 WP_001882831.1.10834 WP_001882831.1.10887 WP_001882831.1.11270 WP_001882831.1.11351 WP_001882831.1.11879 WP_001882831.1.11885 WP_001882831.1.11965 WP_001882831.1.12252 WP_001882831.1.12262 WP_001882831.1.12332 WP_001882831.1.12525 WP_001882831.1.12527 WP_001882831.1.12548 WP_001882831.1.12590 WP_001882831.1.12686 WP_001882831.1.13053 WP_001882831.1.13155 WP_001882831.1.13156 WP_001882831.1.13454 WP_001882831.1.13652 WP_001882831.1.13725 WP_001882831.1.14080 WP_001882831.1.14179 WP_001882831.1.14257 WP_001882831.1.14263 WP_001882831.1.14353 WP_001882831.1.14904 WP_001882831.1.14995 WP_001882831.1.15109 WP_001882831.1.15179 WP_001882831.1.15200 WP_001882831.1.15516 WP_001882831.1.15786 WP_001882831.1.15997 WP_001882831.1.16351 WP_001882831.1.16382 WP_001882831.1.17232 WP_001882831.1.17295 WP_001882831.1.17621 WP_001882831.1.18375 WP_001882831.1.18392 WP_001882831.1.18447 WP_001882831.1.18577 WP_001882831.1.18862 WP_001882831.1.18916 WP_001882831.1.19126 WP_001882831.1.19128 WP_001882831.1.19428 WP_001882831.1.19442 WP_001882831.1.19503 WP_001882831.1.19597 WP_001882831.1.20065 WP_001882831.1.20107 WP_001882831.1.20379 WP_001882831.1.20404 WP_001882831.1.20602 WP_001882831.1.20669 WP_001882831.1.20699 WP_001882831.1.20758 WP_001882831.1.21073 WP_001882831.1.21281 WP_001882831.1.21558 WP_001882831.1.21671 WP_001882831.1.21717 WP_001882831.1.21764 WP_001882831.1.21815 WP_001882831.1.21866 WP_001882831.1.22521 WP_001882831.1.22773 WP_001882831.1.229 WP_001882831.1.22953 WP_001882831.1.2304 WP_001882831.1.23134 WP_001882831.1.23333 WP_001882831.1.2341 WP_001882831.1.23416 WP_001882831.1.23424 WP_001882831.1.23538 WP_001882831.1.2354 WP_001882831.1.23808 WP_001882831.1.23955 WP_001882831.1.240 WP_001882831.1.2401 WP_001882831.1.24106 WP_001882831.1.24280 WP_001882831.1.24345 WP_001882831.1.24399 WP_001882831.1.24952 WP_001882831.1.24980 WP_001882831.1.25649 WP_001882831.1.26020 WP_001882831.1.26156 WP_001882831.1.26223 WP_001882831.1.2627 WP_001882831.1.26326 WP_001882831.1.26508 WP_001882831.1.26580 WP_001882831.1.27186 WP_001882831.1.27435 WP_001882831.1.27458 WP_001882831.1.27639 WP_001882831.1.27863 WP_001882831.1.28431 WP_001882831.1.28508 WP_001882831.1.29095 WP_001882831.1.29535 WP_001882831.1.29708 WP_001882831.1.29889 WP_001882831.1.30107 WP_001882831.1.30292 WP_001882831.1.3032 WP_001882831.1.30360 WP_001882831.1.3054 WP_001882831.1.30927 WP_001882831.1.31096 WP_001882831.1.31718 WP_001882831.1.32111 WP_001882831.1.32264 WP_001882831.1.32271 WP_001882831.1.32814 WP_001882831.1.32955 WP_001882831.1.33093 WP_001882831.1.33625 WP_001882831.1.33811 WP_001882831.1.33819 WP_001882831.1.34108 WP_001882831.1.34195 WP_001882831.1.34261 WP_001882831.1.34634 WP_001882831.1.3514 WP_001882831.1.35201 WP_001882831.1.35266 WP_001882831.1.35630 WP_001882831.1.35880 WP_001882831.1.35881 WP_001882831.1.36322 WP_001882831.1.3635 WP_001882831.1.36354 WP_001882831.1.36441 WP_001882831.1.36513 WP_001882831.1.36668 WP_001882831.1.36686 WP_001882831.1.36874 WP_001882831.1.37054 WP_001882831.1.37260 WP_001882831.1.37262 WP_001882831.1.37537 WP_001882831.1.37676 WP_001882831.1.37784 WP_001882831.1.37999 WP_001882831.1.38420 WP_001882831.1.38590 WP_001882831.1.39514 WP_001882831.1.39675 WP_001882831.1.39853 WP_001882831.1.39933 WP_001882831.1.40039 WP_001882831.1.40152 WP_001882831.1.40433 WP_001882831.1.40459 WP_001882831.1.40470 WP_001882831.1.40484 WP_001882831.1.40491 WP_001882831.1.40542 WP_001882831.1.40571 WP_001882831.1.40740 WP_001882831.1.40782 WP_001882831.1.41573 WP_001882831.1.4175 WP_001882831.1.42128 WP_001882831.1.42152 WP_001882831.1.42498 WP_001882831.1.42617 WP_001882831.1.4272 WP_001882831.1.42783 WP_001882831.1.4284 WP_001882831.1.42853 WP_001882831.1.42865 WP_001882831.1.43103 WP_001882831.1.43335 WP_001882831.1.4365 WP_001882831.1.43884 WP_001882831.1.439 WP_001882831.1.44569 WP_001882831.1.44709 WP_001882831.1.44730 WP_001882831.1.45055 WP_001882831.1.45127 WP_001882831.1.45155 WP_001882831.1.45206 WP_001882831.1.45264 WP_001882831.1.45372 WP_001882831.1.45704 WP_001882831.1.45842 WP_001882831.1.45958 WP_001882831.1.46118 WP_001882831.1.46146 WP_001882831.1.46540 WP_001882831.1.4661 WP_001882831.1.47202 WP_001882831.1.4730 WP_001882831.1.4731 WP_001882831.1.47417 WP_001882831.1.47428 WP_001882831.1.47736 WP_001882831.1.47794 WP_001882831.1.47796 WP_001882831.1.47846 WP_001882831.1.47942 WP_001882831.1.48128 WP_001882831.1.48715 WP_001882831.1.488 WP_001882831.1.48927 WP_001882831.1.49238 WP_001882831.1.49317 WP_001882831.1.50277 WP_001882831.1.50577 WP_001882831.1.50625 WP_001882831.1.50813 WP_001882831.1.50822 WP_001882831.1.50980 WP_001882831.1.51163 WP_001882831.1.51177 WP_001882831.1.51661 WP_001882831.1.5201 WP_001882831.1.52391 WP_001882831.1.52676 WP_001882831.1.5320 WP_001882831.1.53214 WP_001882831.1.53823 WP_001882831.1.5397 WP_001882831.1.54191 WP_001882831.1.5425 WP_001882831.1.54398 WP_001882831.1.5450 WP_001882831.1.54706 WP_001882831.1.54901 WP_001882831.1.55092 WP_001882831.1.55665 WP_001882831.1.55929 WP_001882831.1.55932 WP_001882831.1.56429 WP_001882831.1.56785 WP_001882831.1.56807 WP_001882831.1.57148 WP_001882831.1.57300 WP_001882831.1.57518 WP_001882831.1.57546 WP_001882831.1.57678 WP_001882831.1.57751 WP_001882831.1.57945 WP_001882831.1.58295 WP_001882831.1.58596 WP_001882831.1.58844 WP_001882831.1.58975 WP_001882831.1.59010 WP_001882831.1.59194 WP_001882831.1.59378 WP_001882831.1.59394 WP_001882831.1.5943 WP_001882831.1.59554 WP_001882831.1.59633 WP_001882831.1.59741 WP_001882831.1.59916 WP_001882831.1.60386 WP_001882831.1.60633 WP_001882831.1.60694 WP_001882831.1.60955 WP_001882831.1.61169 WP_001882831.1.61523 WP_001882831.1.61644 WP_001882831.1.61753 WP_001882831.1.61869 WP_001882831.1.61875 WP_001882831.1.61935 WP_001882831.1.62165 WP_001882831.1.62324 WP_001882831.1.62425 WP_001882831.1.63347 WP_001882831.1.63546 WP_001882831.1.63655 WP_001882831.1.6366 WP_001882831.1.63723 WP_001882831.1.63749 WP_001882831.1.63779 WP_001882831.1.63911 WP_001882831.1.64201 WP_001882831.1.64253 WP_001882831.1.64315 WP_001882831.1.64382 WP_001882831.1.64441 WP_001882831.1.65007 WP_001882831.1.65051 WP_001882831.1.65086 WP_001882831.1.65469 WP_001882831.1.66329 WP_001882831.1.66633 WP_001882831.1.66696 WP_001882831.1.67616 WP_001882831.1.68424 WP_001882831.1.68506 WP_001882831.1.68723 WP_001882831.1.68925 WP_001882831.1.69049 WP_001882831.1.69843 WP_001882831.1.69857 WP_001882831.1.70069 WP_001882831.1.70176 WP_001882831.1.70247 WP_001882831.1.7049 WP_001882831.1.70813 WP_001882831.1.70892 WP_001882831.1.71129 WP_001882831.1.72106 WP_001882831.1.72241 WP_001882831.1.72326 WP_001882831.1.72361 WP_001882831.1.72369 WP_001882831.1.7238 WP_001882831.1.72480 WP_001882831.1.72856 WP_001882831.1.73148 WP_001882831.1.73429 WP_001882831.1.73555 WP_001882831.1.73855 WP_001882831.1.73929 WP_001882831.1.74111 WP_001882831.1.74503 WP_001882831.1.74666 WP_001882831.1.74991 WP_001882831.1.75012 WP_001882831.1.75326 WP_001882831.1.75378 WP_001882831.1.75778 WP_001882831.1.76425 WP_001882831.1.76486 WP_001882831.1.7654 WP_001882831.1.76645 WP_001882831.1.77029 WP_001882831.1.7717 WP_001882831.1.77355 WP_001882831.1.77397 WP_001882831.1.77445 WP_001882831.1.77703 WP_001882831.1.77794 WP_001882831.1.77830 WP_001882831.1.77914 WP_001882831.1.78157 WP_001882831.1.78428 WP_001882831.1.78531 WP_001882831.1.79044 WP_001882831.1.79776 WP_001882831.1.79943 WP_001882831.1.80024 WP_001882831.1.8023 WP_001882831.1.80339 WP_001882831.1.80500 WP_001882831.1.80618 WP_001882831.1.80628 WP_001882831.1.80702 WP_001882831.1.80744 WP_001882831.1.80808 WP_001882831.1.8117 WP_001882831.1.81871 WP_001882831.1.81917 WP_001882831.1.82030 WP_001882831.1.82119 WP_001882831.1.82193 WP_001882831.1.82248 WP_001882831.1.82262 WP_001882831.1.82413 WP_001882831.1.82583 WP_001882831.1.83040 WP_001882831.1.83073 WP_001882831.1.83082 WP_001882831.1.83109 WP_001882831.1.83703 WP_001882831.1.83761 WP_001882831.1.84385 WP_001882831.1.84519 WP_001882831.1.84610 WP_001882831.1.8480 WP_001882831.1.85007 WP_001882831.1.85086 WP_001882831.1.85498 WP_001882831.1.85822 WP_001882831.1.85878 WP_001882831.1.85961 WP_001882831.1.85972 WP_001882831.1.85998 WP_001882831.1.86057 WP_001882831.1.86192 WP_001882831.1.86269 WP_001882831.1.86874 WP_001882831.1.86879 WP_001882831.1.87274 WP_001882831.1.87286 WP_001882831.1.87335 WP_001882831.1.87355 WP_001882831.1.87573 WP_001882831.1.87602 WP_001882831.1.87804 WP_001882831.1.88057 WP_001882831.1.88230 WP_001882831.1.88283 WP_001882831.1.88350 WP_001882831.1.88556 WP_001882831.1.8867 WP_001882831.1.89144 WP_001882831.1.89441 WP_001882831.1.89447 WP_001882831.1.89822 WP_001882831.1.89889 WP_001882831.1.8997 WP_001882831.1.89995 WP_001882831.1.90133 WP_001882831.1.90227 WP_001882831.1.90437 WP_001882831.1.90675 WP_001882831.1.90774 WP_001882831.1.90889 WP_001882831.1.91247 WP_001882831.1.91262 WP_001882831.1.91274 WP_001882831.1.91539 WP_001882831.1.91747 WP_001882831.1.91794 WP_001882831.1.91841 WP_001882831.1.92038 WP_001882831.1.92063 WP_001882831.1.92069 WP_001882831.1.92157 WP_001882831.1.92401 WP_001882831.1.92516 WP_001882831.1.92559 WP_001882831.1.92632 WP_001882831.1.92696 WP_001882831.1.92703 WP_001882831.1.92952 WP_001882831.1.92993 WP_001882831.1.9302 WP_001882831.1.93060 WP_001882831.1.93399 WP_001882831.1.93836 WP_001882831.1.93945 WP_001882831.1.94255 WP_001882831.1.94426 WP_001882831.1.94441 WP_001882831.1.94481 WP_001882831.1.94887 WP_001882831.1.95516 WP_001882831.1.95549 WP_001882831.1.9561 WP_001882831.1.95662 WP_001882831.1.95733 WP_001882831.1.95976 WP_001882831.1.96001 WP_001882831.1.9607 WP_001882831.1.96089 WP_001882831.1.96187 WP_001882831.1.96311 WP_001882831.1.96471 WP_001882831.1.9660 WP_001882831.1.96687 WP_001882831.1.96693 WP_001882831.1.96704 WP_001882831.1.96980 WP_001882831.1.97100 WP_001882831.1.97144 WP_001882831.1.97516 WP_001882831.1.97552 WP_001882831.1.97650 WP_001882831.1.97799 WP_001882831.1.97832 WP_001882831.1.9787 WP_001882831.1.98021 WP_001882831.1.98116 WP_001882831.1.98172 WP_001882831.1.98246 WP_001882831.1.98280 WP_001882831.1.98624 WP_001882831.1.98642 WP_001882831.1.99128 WP_001882831.1.99204 WP_001882831.1.99417 WP_001882831.1.99452 WP_001882831.1.995 WP_001882831.1.99872 WP_001882831.1.99949 WP_001882831.1.99992 gi|147671432|ref|YP_001215035.1| gi|360037942|ref|YP_004939704.1| gi|147671432|ref|YP_001215035.1| 243277.VCA1047 345073.VC0395_0194 579112.VCM66_A1005 593588.VCD_000293 gi|227812611|ref|YP_002812621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]