SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EgrG_000183500.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000183500.1
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily DNA clamp 3.45e-43
Family DNA polymerase processivity factor 0.00000952
Further Details:      
 
Domain Number 2 Region: 127-259
Classification Level Classification E-value
Superfamily DNA clamp 2.14e-40
Family DNA polymerase processivity factor 0.00000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EgrG_000183500.1
Sequence length 260
Sequence
MFEARLPQADVWKKVIDAIKELVQEATIDCSDTGISLQAMDSAHVSLVSLLMRSDGFETF
RCDRNMSLGLNIASAAKILRCAGSTDSITLKAGDKADTITFLFESKNQEKVSEFELKLMD
LDVDHLGIPETDYKCVIRMPASELQRICRDLGQIGDSVVITVAKDGVGFSSTGDLGSGKI
KLSPSGNADKPEESISIEMSESLTMTYSLHYFNIFAKAAPLSSQVILSLTADVPAVVEFP
IEDLGHIRYYLAPKIEDDEA
Download sequence
Identical sequences A0A087W0L0 U6JI50
EgrG_000183500.1 EmuJ_000183500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]