SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EgrG_000846500.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000846500.1
Domain Number 1 Region: 55-104
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.00000000000000837
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00068
Further Details:      
 
Domain Number 2 Region: 7-56
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000254
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EgrG_000846500.1
Sequence length 152
Sequence
MSDDYHEMYRGTTLGNTLRESLDEMLDHSLLKPQTAMKIMKKFDQCICTALSTQVKARLN
LQGYLNAYRNCDNVWTLVLNNVEIKDGSGAMHVDKMKIVACEGKHSKSAPAQGSQKTTAN
ASRVGSGYSGPAQHGDADSGNVDEDRSDEDVL
Download sequence
Identical sequences A0A068WEH2
EgrG_000846500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]