SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EgrG_000467200.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000467200.1
Domain Number 1 Region: 408-805
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.17e-104
Family Ankyrin repeat 0.0000000377
Further Details:      
 
Domain Number 2 Region: 171-426
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.31e-71
Family Ankyrin repeat 0.00000371
Further Details:      
 
Domain Number 3 Region: 18-238
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-57
Family Ankyrin repeat 0.0000289
Further Details:      
 
Domain Number 4 Region: 1490-1554
Classification Level Classification E-value
Superfamily DEATH domain 0.0000345
Family DEATH domain, DD 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EgrG_000467200.1
Sequence length 3707
Sequence
MVETANTAGSHTEPKQGFLRAARSGNIGKIAEYLNSNVDINAVSSNGLNALHLASKEGHL
PVVRLLLDHHATIDAKTNRGNTALHIASLAGRSEIVRLLVERGADVNAKSQNGFTPLYMA
AQENHTEIVEYLLNKGADQALATDDGFTPLAVALQLCHDAVVSLLLERDSGGKGRLPALH
VAAKKDDVHAVSLLLANNDVNVNHASARGFTPLHIAARYGNLKVARLLINNGAEVNCCAK
DSITPLHLSAKWGKVEMTQLLIDKGAQLDARTRDGLTPMHTAARSGHTNVVQVLLNAGAS
ITAKTRNGLSPLHMAAQSDHADTAKLLLKKGSPPDDVTMDYLTPLHIAAHCGNMKVAQVL
LDHRCDPNLRAFNGFTPLHIACKKMTVKIVELLLKKGAIVDATTQAGLTPLHAAAFVGCS
DAAAPLLQRGANVNQVTMRGETPLHFAVRGRHVDTIKLLLKHSASVNAKAKEKATPLHIA
LRLMDSEIVKLLIEAGADVQLESRGKHRPIHLAAKVGDIEIIRLLLEKGAQVNAGTKRGY
TALHIATKYGKIDAVRYLVDEAKADANAAARNGLTPLHVSIYYQYPQVVEFLLSRGADVT
AKCKNGFTPLHLAAKANTPEIATLLIKANAPIDCVSQNGYSPLHLASMEGNFTVVRTLVD
DYSAQVNCSANDGLTPLHLATQVGRVDVAEFLLAHGASQNIQTRNGYMALHEAAYRGSAP
LVRLLLAHPGKEGAINSRTIMGCTPLHLAAQQGHSQIVDLLLNAGADLKSRTMQGWTAAQ
VAKRQHYPSIFESLSRVTTTVSDWDTPSLEGASADGLSQGDPALVDGSMILDSPTQMLDR
VALVESEDESDQLVSTPVIMRHHPRGQRKASAGELSLFKSPSYNLLCKQMEYTRAHKGEP
KIRISALDSTMEEQTRVSELMGTSTLSVQKSDIEMSGATPLGSSEWEAFEAEPIQAVCKP
VKAGFLVSFLVDARGGFVEAQRRPNLRFLIPPHAISSPTRIICRLLRPDRVSRLPHLNDG
DAFACRIIEMSPSSVRLDGPILLEVPYFASIQGRDREVITLRCDHGDSWKAHPLEATDQS
VQDALGTAFGQIELLKSIRERRIQRILTVDVPRFFALISRFRQEIALIGPDGGVLASTVS
PKVQAVFPKGALQKRIKVGLQAQVIQPYVVNKMVGNRAAFSPVVTLEPRRRKFHKPITVT
IPLPRQSLKGVHKSDPLPPSLHLLCSITAGCAPATWEDITGSTTMTRHKDCISFTTTVSA
RLWLVDAQGIEDVAEMASRVYQESIIPPYIGRFAVYARLPEDRQEIEANEAAASISTSAA
DAISAATSVASRFRRKVFHPADAELRCICLIDDAPEKTLEQHEKFQLVAVGPPTEVSESK
TYWLETVGDISSYPAHTGQLTLDVQAFQENRLTYPVRVRQPVGTKTPPTGHLRVYREPQE
AYGARVATDEEEPITVLEIHMPGDAVEGRWLDASTSEEVSTKAMRPELNIREIALRTNAR
WPQLAKELGLSPEDIKMVERELLAGEQIGQGADSERCQHMLALWMQRSAAMGTLSPEDLA
SRMREALQKLGVHLDDRTAELDVQPVTSRVHHIDEEMTSSKTPSLVHSIQMVSAITPQHT
PPPLPLIAADHVITAPIAAEAAVPHPGSESPTVPTMDQTPPPTAVDGTPRTVPSEEVPYI
LTSSIKSASLERPLSMVASFPSSKDGLGLPTDEIKPVSDEFIVASESLTRKNLLPPEEII
VHADSVARQIAAEELVEALGLDSDVHMISVISQSADHEDLLVTEAKIEPVKSKPKQEFSP
LMSRAAAEAGRAETPVVGPTDTLHIEADDELRVPSMEQLDNADEDFEAAYRAAAAEGTPS
PTGLAGHDVHQGRPEEGFLIEEMEEVLPDGTVVKQRVQTAETIQALSAHDWEEAVFNAAA
AGGNDQYIIEPPEEVVKVEEVEETLADGIVVKKRITTQHITERITEREVTDEVSENELLP
NEADGGVVESNNEGIYSDNVKEKQNKSVIQTRADGQDLKPQNEGKAYIQDMNKKKTKERG
EVRKKQERKINIKDKEQKYLTKAKEKVLQEDEKEEEAEELEIEQKAMAAKVGESRRDTRY
AVEKKGHRNEEIKFEGPITSILPEISQENQENEEIDGGAQEEKMIVEKKEKRKLKEQKKE
QNKRKNIRMKIELAETSMEAEEGAVVEKAEEVEGEVAVAVAVEGEGEGEGEGEVKGEAEA
LGEAEAEAEAEAEVEAEAEAEGEGEGEGEGAVEGEAKAEAEAEAEGEVEAESEGKGEAVA
VADAEADVVSKLVSDFEFLPLSESVSELCSRDVNELPLPVSLSGGVVLPESSSALFIDDL
PFSCNEPFECSSSGLAELSDMQDVTSNFGGLVDLEVVTPAVAECSPCFSSSRTRLPSLSP
RSHGLNFFSLIENSSQLNFEFVEECPFGLSNLFSASLSNRVQDVFDAHPVESALLVSSDM
PSEICVPVSDSSRFLTSSSPPLLPVSDLLIPVSHPIGMEISETKESKESVPLHLGLTHDD
LLYVEQTKPLEYATAKAKYSHSDGSGRDVHVGLIGSADETISKVKSLPPGPSPLQAVSIE
TEDHLSALPGVSTVSPSEAAIYIDETGNELPIVFSRTTTSESVRPLDADHNLKSAAFLAV
TESEHIDSFTASQRQANMPEVVSADKCLTRHLSLSSSRSLIGSVETPPHVSRFSDSSLEI
RVKVPRRLFYAANTQEVVWEEVVLFDHGQESPLPFPNVSVIVPIPEPNLSIAPQRSFAQD
SEGEPPMGENNDLVPTYASLPWPKAKEYETTHHTDIIVGTGLGASAPEICTDKAGLEPSA
EVMNLLSVVPISSAPVSGELMMSDVSPAIESLSSPTLSSSIKLHQEPMSSELDVYILSPC
SSEEGKVVPGTNKDEPSKGQFVSSESTISGEEKVEEGTWDDLSQLAAAAGATLAAEYASE
DDEEEDEDDDYEFKSVGFELSRPRPAPETTLDRSSQLLSRLKFYGLGTQQVAQPSPRLYD
VERGMSKDIEENENIEEQVAEEVILDDEEEEDEEEHPKIMVEDLDSILPTIPEVAGLVTP
DDDDSLNDDEIPMDLKLVPAHEEDEEEDTSLAFSRPVSEYRQQVQSLSRLSASSERSSFT
ATVTDTTEESSKESQATVIQIGSDTLTNAGKTQEASRTTLASLDSDLNLVDETRLSDSFP
QLPKETIDASMQEQVALATAISTDQVTEDKSSGSRHCADTVSTPSILERSTSSGIYCPPK
GRLQGFPRKGDPGASEPALSKTEATASQSPSLAEFERLEQQMIANSSPDSLQKTSGELKK
DSSSRTSSSVSEFERIEAEATKPFSASSGEIPSATKGAGDSSLSSLSDFLRAEQECASSQ
ESVQQQPIDSQLTALTHKTISTIYEDVLAEQMCQSVETSRLTDSSEIVGEVDSLVQSSIH
DSLASSSCQREVLPIDLIRDVIRGARDVLEQRYPRDHDSLGEADSLEEDFPQIMETSADS
LDGLQQHSQQGQWGDSSLSSEANYSRHMTDSLEDSGAAMASGSRASTQPPSQSEVLFLPL
LGPPPIPIQSSELPQLSIPRSTSGDEALLKKTDTDEETSFKRLPVSASITSLNLAQGHVP
ISQTDSNLGSTVFDVSEDEFKGPAHPGASVTESPLKSLSSSPVLIHGRDVEDIPESSSPI
TPMAGPFSPKDISTPTMTEISSVVDEEIGKDFEIIRAADYDFPHEQK
Download sequence
Identical sequences A0A068WNX1
EgrG_000467200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]