SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EgrG_000638400.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000638400.1
Domain Number 1 Region: 412-806
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.68e-107
Family Ankyrin repeat 0.0000000117
Further Details:      
 
Domain Number 2 Region: 117-428
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-88
Family Ankyrin repeat 0.000000855
Further Details:      
 
Domain Number 3 Region: 21-141
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.15e-35
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 4 Region: 1518-1601
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000572
Family DEATH domain, DD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EgrG_000638400.1
Sequence length 1924
Sequence
MTRGTDPQHGSTKRGGESGENLLRAARAGDLKKVIDLINSGVNINATNPTGLTALHLAAK
EGHTAVVKELILHGADVNATSKKGNTPLHIASLAGHLGVVRALVDANANPNCQSVVGFTP
LYMAAQENHLDVVILLLNKGANQSLTTEDGFTPLAVALQQGHDRVVATLLERDTRSRGGL
PALHVAARKDDVNAANLLLMSPDANVNHQSQPGFTALHIAAHYGSTNVGALLIQRGADVN
FQAKNNITPLHVAAKWGRVAMVKLLLDNGASVDSRTRDGLTPLHCAARSGYNNVCTMLID
SGCNPSAKTRNGLTPLHMAAQGNHDEVTCNLIARGASLQATTGDFLNPLHVAAHCGNLKV
ARILVERGCDMNARALNGFTPLHIACKKNKIPVVELLLNRGAQISSTTEAGLTPLHVAAF
IGSPDLVRLLLEHGVSVEQATMRGETPLHLGARSCNLEVAELLLTHGAAVDAKAKDDQTP
LHIATLCGSADMVLLLLKFGANPNMTTRDAYTALHIAAKDGRADIVQCLLASGADPDART
RRGFCPLHLAAKRGRAEAARTLLQVMRPELVNAVGRNGLTPLHMAAHYNHVPLVQLLLEF
DAEADRPAGNGYTALHIAAKRNHQDLAALLLANDRDPIRSTNRESRCGFTPLHLAAQEGN
SDMVGLLLLNGADAEHKAKNGVTPMHLAALEDHVTVAQQLVHEGAQATAMTQAGYTPLHT
ACYAGRLNMARFLVALATSDINAATNTGFTPLHLAAQQGHSDIVYLLLEHGADPNARNSQ
GLTAAQIARHQHYLTIFDTLRTVTTVITNWDDVKETYDTEILLDLPEIVTTAKEAAEAVE
SDEEGMALSRKVGRTTAYPSQYQAEYVKTSSQAANTLHPSESAYENDLIWGEMEYLSQPL
RSRQPTIGSGDEQVLHETSVVPQHNTSLSATLTSDLHMGESSRVLAGPGDNLDAEWEMET
EPVMSTSKKPLAGGFLVSFLVDARGGLLESKRYPGMRFIIPPNASVGPLRIICRLLRYPS
YAIQPPLNDGEGLACRLIEVGPVGVRFNAPILIEVPYCASLRSSQREIVVLRSENGEIWK
EHPVDPTDQAVQDSLGEYFVDATPSTELRRRRVHRILTSTIPQYFALITRTRQDLVIVGP
DGYVLTSSVDPQVKVTFPRGALQKKIRVGLQVQTVDPGLVAACLGSPRIAVSPIVTIEPR
RRKFHRPIVVFIPLPTVAGKGAQQQQKGQAPPDLSTVRLLCSITGGTAPAIWEDITGSSP
FSLQKDCVSFTTTVSARLWLIDCPNLSEVSEMAMRVYSEATAVPYLGRFVVYARRHHPEE
ARIRCVCLTDDSEQKTLECQEGFEVVARSGEGLVEFLHNRPVWLETAGNLVPVAASHAAS
TTDITTVVDQLRFPSIRAFEENRLNVLLRIKDLNSPPAGHLAFMPQQRQPGGVSVNPLCV
LDLLLPRMVASSISETEVSARRHSSQKGTATAATGTGATAASLGNFFNSNVKHSSSDEDC
GSVGHRYGKCRMVESIARSDLDVKKVAVNLGADWVYLAPYLGLSAQDVSDIRANGVDSDY
KMALTCLTLWQERAGPQATGTALAHALKQAGREDVLRQSMQNISLVQTDPELSHALRSLE
AADKAPTVGQVEGEKAKEMITEKVEVEAKPHQGVIEPAIVDDGVLEMAISPPTEASPQHK
ETSSEERKAALEALAVQLNEDSFELPSAAGPADTGDTDGVSEKEVVAVAVKRNVQLESAV
PAFLLEEMRQQEDTTSTLDAAPRNEPFDIDVDTASTTAVVGVEGSTLISTPTDENARKPS
VHAELTISGLTQPTLERTPEMASEDGKSLWIAPGDAKESSTNGDLEAKVEAEVEKAVAME
SVEAQGDVIIQPVAVPMCGVSEATWGRAQSPPPSPDFDIPLIVPTVVERLGEREDTWGKP
QQLD
Download sequence
Identical sequences A0A068WFQ4
EgrG_000638400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]