SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EgrG_000803000.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000803000.1
Domain Number 1 Region: 433-637
Classification Level Classification E-value
Superfamily Smc hinge domain 7.72e-49
Family Smc hinge domain 0.001
Further Details:      
 
Domain Number 2 Region: 954-1166
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.06e-33
Family ABC transporter ATPase domain-like 0.0000308
Further Details:      
 
Domain Number 3 Region: 1-167,1076-1163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.63e-30
Family ABC transporter ATPase domain-like 0.00017
Further Details:      
 
Weak hits

Sequence:  EgrG_000803000.1
Domain Number - Region: 619-709
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.000549
Family PspA lactotransferrin-binding region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EgrG_000803000.1
Sequence length 1189
Sequence
MDAISFVLGERTRHLRVTKLSDLIHGSVVGKPVAKTASVTAVYQMPDGVDKRFSRYISGN
TSEYRINGTPVKVEEYAEALEKIRIFMKVKNFLIFQGAVESIAMKNARERCQMFEEISRS
AEYKEEYDRSKAEMQKLEEEATFNLNKKKNIVAERKEARIEIDEAEKYKKLHHKWLSKRT
ELQLFRLYYNDVDIKRIREDLQQREEIIEQENTQRQQIEEEIRDKRRELGKLHRDQAGLE
QEIKKCDQKVSKRKPEYIKVSQMLRHVSDKHKESKKALENARQQHSSHRQEMDQLEAEYS
RILALKEDYEHQQNKKSKEQGRSLELEDSQLAEYHRLKQKAAEHTSDLSAQLDALRREYD
EQKDLFDGLERRKEEIENSLRLKQTELIDNQRRLQRLVEFIETSHRSITELSEAEKTIRE
EVESATRRMDEINAELETVICQLGEAKVERHESSRAVKKQELIENLKRLFPGVHGRLLEM
CEPSHKRYQIAITKVLGKHMDSIVCDSEKTAKDCIQYMKDQRIEPETFLPLDFLDVKPVD
EKLREINEPPNVHLVIDVINCDPVIAKKALQFACGNALVCDTVEHARYVAYNMGDRKKTV
SLDGTLFQRSGIISGGASDLKARAKRWDEKQISSLMARRDALQVELKEQLKRKRKEAELR
TLQSQINGLEKRLKYTQKDKEGTEEKILSGNEEEVNNLKVNLEEVNERLSMCQTKMQELQ
ISINAEKAKMDNVEDTVLHDFCVSIGVENIREYEDRELRIARERDRKRMEFTNQLQRINN
QLEYEKSRDTQAAVRRWEEAVVSERQEMERCKKQEKRLKEEMEAEEIHKGNFEFQLSEYQ
RKCERLDGELAELSRRLVSRKREIQKLQKETSQIETRLEAKRSERHSLLQSAKMEDLQLP
LKPGASSMPELESQLSAESEGADLNSEEMMRLYVMEARLPLDYKQLEKPLRMIADDKEVS
RKVDEMQAEVDRMQSELSRFQAPNLKAGAKLGNVEQRLRSTEAEFEETRRKAKKARAQFE
RIRRLRCNAFMKCFLSIADNIDPLYKALSRNPGAQASLLPTNAEEPYLEELQFQCVAPGK
RFQQMDSLSGGEKTIAALALSFAMHQYNPSPFFVLDEIDAALDNTNIGKVASFIREYSRT
RAQVIVISLKEEFYSRADSLVGIYPDTENNCLVSRVLTFDLSKYVDTEE
Download sequence
Identical sequences A0A068WB35
EgrG_000803000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]