SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EgrG_001022900.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_001022900.1
Domain Number 1 Region: 2202-2505
Classification Level Classification E-value
Superfamily BEACH domain 8.89e-119
Family BEACH domain 0.0000000131
Further Details:      
 
Domain Number 2 Region: 2094-2202
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-17
Family PreBEACH PH-like domain 0.0087
Further Details:      
 
Domain Number 3 Region: 2808-2895,3049-3171
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000033
Family WD40-repeat 0.0092
Further Details:      
 
Domain Number 4 Region: 431-551,612-660
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000259
Family Laminin G-like module 0.047
Further Details:      
 
Weak hits

Sequence:  EgrG_001022900.1
Domain Number - Region: 1020-1134,1222-1265,1369-1506
Classification Level Classification E-value
Superfamily ARM repeat 0.00321
Family B56-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EgrG_001022900.1
Sequence length 3227
Sequence
MTAAVAAGEDLERSKVIIECLTFLLQRLFVMDEIHREIDPADAVTSFCTVFANRKFLHPS
DILCMAVLLQTSPEFKMAIAAQFPLLLPVFQRTLAQDQLNDCIPSLMGALALATTRVTIE
LRLPSPNANTELLRPIGFSSDRGVCREEAISCGLYSQILMTLKECLLKRSKSKKDMYRIL
RAVYSWADGSAVIPWLHEGISDADGLPKASTLQTIIDGNAFGLFVSLACELAFSDASQDT
SEAFACFEISQEALSQDNSSGRKSLNEASKSGFIRGVITPYLLRAFRSWDKFTNDASFSI
TNEVPNHDSKKTISQLIDYLLILLKTVGLHSAPLEDVASILSLLRQDCVKNKTAILLRTL
TNVIHPTKSPVLGQPNGLFSWFEFESPTDSLLIVPSVDVDDHSAIKRLSEFVSRSPGPGS
DQNQAAANTDNGSIFPGALGLTFFFWIYFDAPSSRSTSSRPQRSCLLRMLSVAGNGLEIF
LSSTGELFVATAQSGEFCYVSVCSPSCIPCNKWTALSLVFSNSKGFFAKSTLTVYVNFDR
VFEGEFRYPLIKEDLLLFHYGGCPLWVEEICYSMLTLKLPPKALDAKSTKVRGSVLLSSL
GIGNRGVTTKKVPGLQQVSIGGERPLWGPLNAFRGRLAYAAVFNDPASEAFIQWLVQGGE
NTCTLVTDLILRNPQHPVLFYYHAKAVNDASTLCLDLALSGIGQSSLLTGCGITCEPYNL
PAYLHGVVRLSSSTLVDSIYRLGGLQFLLPLFDLISKHQRDVDRTKVPSCTLDELFASMT
EFREALGSAEQSSTLEVEPPPVSKQPAAMQVMDAMTDETPEQTVLCATIEVFQLATTLLT
SSTPFASFNLPVTGRSTSRVSVLFNFFKTTFKADTRVRLNFLHPSVVLAMGHLLNSTDPL
QLDANAVTSFHSMLDLCANSVLIDLNSRVEASGDFASSSQQAEEKRTARETFRVRWTFLI
KQLFVDWALWSRFSPVATLQHVRHLLKRAKTIRSIYRGHFPIFRLLTAAGFYFAPKKTFN
EAFKPVFSLLSPKTRDSVELSLIEAYNILMKHIRQGLYSIIRVLYAKDASKSELRSLFAF
LESSAHPDVIAEVIVLISQILNNTPPGDAFLLFAYEREMVEKIYSVLLAPNERMHRPAKV
NALKLLYKLAATERVADKYKSNLFFGNSGGFQGFFAQTASIRELTFHSDTCQLLHYLIGR
TFRKDYAGLLQYLSLLRMGQLRQRIAAVSLLLDLLEDEKSLPLKDIQSFPAFYESLIDLL
INSKRIDTRASLSPASNELEDICENTNGDSLLLSPHGRKLQRRSSLHVCAQHRTQNAPST
SSFSASLSAEMPLDSNDDLPPTHSMETRFSSSGVSTPHDHPLLYALSLEENDEEREALEE
TLGELVVKALHRLLWPGSTLILAAVPNNDQIGDALSKYYQVFVSISDSTAVYKFIKPYFW
VVQRVLEEFLKSINNCLRTTGPNSQTSCSFPGVSPFIRMIVDETCNRGVSDESEFRTELL
DHMSELMLDRLRVWDVSARPEESVALALHFFLTWASRGAFTHNGAAAQSCARLHDAICTF
NDNAALERIIFLLFRIDSMIQATFNGQSDLIKDNSLILSVSPSGQSFKSSDTDMFHTDSE
DSSASTSNPEPYFFYAPLLKALLDNYHDKLQIEQLAPHLPHKSANFFTEFREYSMHYPNE
WHGSFLDSFQSEMETYTRKHIVNLSTEQSLMRALANESLIKARRERSKQTVLATQRLAEY
HPTLTPPGHSAERSPPSNMLRVPAPTSNFRRGSFASRSTASPASPLVPPEGTSQQLQQQY
KRSPMSIVDPFDYQLMERETRVLANIRRKRWLNLRFEFVRASSTALWFSPFPQEIRWRLS
DLESSFRMRSMMEPNPWFSKHLSASEERDGFIRKLSTLEDGKRLLQKLSTVISDEQLCVL
LQQTEGKNVTSKYPLVDEDPSRPPLMRSLSAVQCGVLSALAFDQTGVLRQRIRKGSLVGY
KDLKGDFVADDDWKMIKQGDSDKSCDKLDSNSSTELSKASNDSDQAKSEIDEFSVNSSVT
TDDYAKTHEKLVKGGVKEKTSGEGVGDDEEEEEELVLPASLFFEEPAPLKGEVMRAPCQL
ISLIRIVPGWFAITPTSLHFLQNRAEPVSFEIDVAGDDQFRKSECTKDFSIVLSMNDIRE
VHLCRYNLRRSAIEIFLIDLQNYLFNFPANYRNKIYTCIMSHNMPQLIYRKGRSPAEVFK
FSRLMERWANREISNFEYLMRLNTIAGRTYNDLSQYPVLPWILADYTSKQLDFNEPATFR
DLSRPIGIVNPNNITTVREKYESFEDPSGEISKFHYGTHYSSAAGVMHYLVRIEPFTSLH
IHLQGQRFDIADRQFNSIPTAWSLIMSSPYDNRELIPEFFYFPDFLRNDNGFDLGRPQLS
GEKVNDVELPPWASTPEEFIRIHRGALESDHVSANLHKWIDLIFGYKQRGKAAENALNVY
YYLTYEGAVDLDDVTDPVERASIEGMIKNFGQTPCQLLKVPHMARISYPEWVYKMLVQRQ
LPILNAAIIYMKTNMEFSSRGTSPERDADTRSQQKLSVRLARQRTRSTLISDEQPPIELN
QHTIEIYFSYHPAPKHLGYVHSPVFSAVKPHQVVELPDLRIATPVEAADVLSQKRASLHD
ELLLNNSTRSRFVSGLKSIIPSPSVAGTIGASVGNISVNLTSTTSSHLTHQVVTVDSAGW
VRKHLLTPLVQNEPGALSESELLQQIQGLKKSPFRTEGEETIIVSQRKGVTTDPEPISPA
HIDQECLQLSPISMRQRFLGPLLYPPRECTSRAPKSRTKYPSTHLYAMSTNGCHLYAAGR
WDNRIAVYSIQTCRLDTLVTTPHTDVITTLAVDPGCYRKSAQQGSAAQYLITGSRDGTVC
VWNFTAFSGKMIKQVRADRSFIEDFEATKKLETEGAKNVSFTQSVSPGSSSGSGGGAVKR
NNSHGYPADMQEEVEACIQPGMPFDDSMLNFGCGCKVTDVGATSGRRTSITSSNFVSTSP
TEVAKVIRLFPADESGLPISNVALYLSLDIALCASFGSNVIRMHAVKRGVWSRQVTLPEL
VTINHLLIHPVSISFLVQWTAKSSRDRQLRLTRFNVNGRCVAEASVFQEGYISPPPPPAN
TQVTRMLTAVLSPSANTRCVVNYVLLMATSSGHLIMQEVESLTQLRIFSIGAPIVHMNMA
LTVHGGGVNILLLLANGAFVVAYPGLTAPLTTLTAAAQAPVATNESL
Download sequence
Identical sequences A0A068WCK4
EgrG_001022900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]