SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|527326281|ref|YP_008352474.1| from Chlamydia trachomatis RC-J943

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|527326281|ref|YP_008352474.1|
Domain Number 1 Region: 353-372,447-653
Classification Level Classification E-value
Superfamily HAD-like 1.61e-51
Family Meta-cation ATPase, catalytic domain P 0.0015
Further Details:      
 
Domain Number 2 Region: 156-250
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.62e-19
Family Calcium ATPase, transduction domain A 0.006
Further Details:      
 
Domain Number 3 Region: 101-153,251-339
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000051
Family Calcium ATPase, transmembrane domain M 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|527326281|ref|YP_008352474.1|
Sequence length 659
Comment cation transporting ATPase [Chlamydia trachomatis RC-J/943]
Sequence
MSPQLFSSPFSRELLSDFFESGMAEENSPLLSQKNRRLSQNLTLKSAYISLALYLGSLLS
HWIGYQALSSLLLILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGA
LLLVLFAISESLGAMVSGKAKSTLASLKHLAPTVAWVVQQDGSLQKVLVQNVKIGEIIRV
KSGEVVPLDGKIIHGASSINLMHLTGEKIPKSCGIGDTIPAGAHNLEGSFDLQVLRIGAE
STIAHIINLVVQAQSSKPKLQQRLDRYSSTYALTIFAISACIAIGGSLFTTLPFLGPDGA
FYRALAFLIAASPCALIIAIPIAYLSAINACAKHGVLLKGGVVLDRLVSCNSVVMDKTGT
LTTGDLTCSGCEDFGPESPLFYSCVLAMEQSSSHPIAQAIVNYLTEKQVRSLPATQCTTI
PGEGVSGEFNGEQAFVGRVSTALRYVPEEYREQLRERAQQAQERGDTCSIACLGKRVSLF
YFRDVPRHDAANIVSYLKKNGYPVCMLTGDHRISAENTARLLGIDEVFYDLTPDNKLSKI
QELAKSRQIMMIGDGINDAPALAQATVGIAMGEAGSATAIEAADVVLLNQGLSSLPWLID
KAKKTRRIVSQNLALALAIILFISGPASMGVIPLWLAVILHEGGTVIVGLNALRLLKNT
Download sequence
Identical sequences A0A0H3MCG9
gi|527327203|ref|YP_008353395.1| gi|478447569|ref|YP_007716257.1| gi|482546130|ref|YP_007852046.1| 471472.CTL0096 gi|482545188|ref|YP_007851106.1| gi|527319499|ref|YP_008345700.1| WP_009873330.1.100883 WP_009873330.1.11148 WP_009873330.1.17082 WP_009873330.1.22210 WP_009873330.1.27980 WP_009873330.1.58046 WP_009873330.1.60427 WP_009873330.1.61004 WP_009873330.1.62489 WP_009873330.1.67104 WP_009873330.1.71307 WP_009873330.1.83642 WP_009873330.1.85365 WP_009873330.1.87079 WP_009873330.1.95142 WP_009873330.1.99598 YP_001654187.1.27483 gi|527329054|ref|YP_008355244.1| gi|527324222|ref|YP_008350418.1| gi|527325355|ref|YP_008351549.1| gi|527318573|ref|YP_008344775.1| gi|527328128|ref|YP_008354319.1| gi|527320449|ref|YP_008346649.1| gi|166154069|ref|YP_001654187.1| gi|527326281|ref|YP_008352474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]