SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.A00308.1|PACid:23562025 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.A00308.1|PACid:23562025
Domain Number 1 Region: 19-99
Classification Level Classification E-value
Superfamily At5g01610-like 6.8e-19
Family At5g01610-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.A00308.1|PACid:23562025
Sequence length 124
Sequence
MRISLPVVLFLLFSLLVDSSDLPDVPARPVSRAHAELTAYGFPIGLLPADVRGYSINATS
GDFAVDLHGPCRLTLPPDNYLAAYSEKITGKIVRGRIARAGGDPGQALFPVVVHHRDQVE
RRDL
Download sequence
Identical sequences A0A059DBU0
Eucgr.A00308.1|PACid:23562025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]