SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.A01004.2|PACid:23562727 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.A01004.2|PACid:23562727
Domain Number 1 Region: 672-892
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 3.01e-61
Family Helical scaffold and wing domains of SecA 0.0000306
Further Details:      
 
Domain Number 2 Region: 22-208,329-376
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.99e-60
Family Tandem AAA-ATPase domain 0.00000157
Further Details:      
 
Domain Number 3 Region: 377-486,583-666
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.41e-50
Family Tandem AAA-ATPase domain 0.0000101
Further Details:      
 
Domain Number 4 Region: 207-329
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 2.09e-43
Family Pre-protein crosslinking domain of SecA 0.000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.A01004.2|PACid:23562727
Sequence length 953
Sequence
MASLGGLLGGIFKGGDTGESTRQQYAGTVSVINGLEAEISALSDSELRDRTSVLKQRAQR
GESLDSLLPEAFAVVREASKRVLGLRPFDVQLIGGMVLHKGEIAEMRTGEGKTLVAILPA
YLNALSGKGVHVVTVNDYLARRDCEWVGQVPRFLGLKVGLIQQNLTSEQRRESYLCDITY
VTNSELGFDYLRDNLATETRTPLIVSGPAEKPSDRYYKAAKVAAAFERDIHYTVDEKQKT
VLLTEQGYEDAEEILEVKDLYDPREQWALYILNAIKAKELFLRDVNYIIRGKEVLIVDEF
TGRVMQGRRWSDGLHQAVEAKEGMPIQNETVTLASISYQNFFLQFPKLCGMTGTAATETA
EFESIYKLKVTIVPTNKPMIRKDESDVVFRATTGKWRAVVVEISRMYKTGRPVLVGTTSV
EQSDLLSEQLKEVGIPHEVLNAKPENVEREAEIVAQSGRLGAVTIATNMAGRGTDIILGG
NAEFMARLKLREMLMPRVVKPVEGVFVSVKKPPPKKTWKVNVDIFPCELSSRNTQLAEEV
VQLAMNTWGQRSLTELEAEERLSYACEKGPAQDEVIAKLRSAFREIAKEFKVYTEEERQK
VVQAGGLHVVGTERHESRRIDNQLRGRSGRQGDPGSSRFFLSLEDNIFRIFGGDRIQGLM
RAFRVEDLPIESKMLTKALDEAQRKVENYFFDIRKQLFEFDEVLNSQRDRVYAERRRALE
SDDLQSLIIEYAELTMDDILEANVGPDAPVESWDLEKLIAKLQQYCYLLNDLTPDLLRSK
GSSYEELQGYLRLRGQEAYMQKREIVEKQAPGLMTEAEKFLILSNIDRLWKEHLQALKFV
QQAVGLRGYAQRDPLIEYKLEGYNLFLDMMAQIRRNVIYSIYQFQPVLVKKDEDRSQNGT
TGKPTTNGRSSGKPDPVGVESSSSAASPQDVCSIKSGSGMNNKPCEASFAYGQ
Download sequence
Identical sequences A0A059DDZ3
Eucgr.A01004.2|PACid:23562727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]