SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.A02065.2|PACid:23563902 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.A02065.2|PACid:23563902
Domain Number 1 Region: 117-261
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-49
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 756-838
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000026
Family PB1 domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.A02065.2|PACid:23563902
Sequence length 868
Sequence
MRLSSSGFNHQSPEASNAGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAAS
TNKEVDAHIPNYPNLSPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDLYLLPAE
LGTPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDN
EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVM
PSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPSPSEFVIPLAKYVKAVYHTRVSVGMR
FRMLFETEESSVRRYMGTITGISDLDPVRWQNSHWRSVKVGWDESTAGERQPRVSLWEIE
PLTTFPMYPSPFPLRLKRPWPSGLPSFHALRDGDMSISSSLMWLQGVGDQGVQSLNFQGF
GMTPWLQPRYDTSMAALQTDVYQAMASAALQDMRAVDPSKCASQSLLPLQQSQNVPMGQA
SIIQRQMLQQSQSQNSLLQGFQENQATAQGQVLQHPSYNDQRQQQQQHQQQPQQSQQFNH
TSLQQQMPNIITTLPQYGSIGQSQSSSLPAISQSQQNIFSDGMENPIVASDVSPMQSILG
SISRDGSSQLLSVNGSDSMISSSLLKKQNSVEPHLLSEAAHCILPQVEQLATTHTNVSEF
ANYLPPFPGREYSAYPGATDPQSSLLFGVNIDSTSLMMQNGMQHLRNIGSEHDSLSVPFG
TSNFASVAGTEFPHNSDMATSSCVDESGFLQSSENVDQVNPPTRTFVKVHKSGTFGRSLD
ISKFSSYDELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDILLLGDDPWQEFVNNVWY
IKILSPHEVKQLGKQGINPANSVPRQAL
Download sequence
Identical sequences Eucgr.A02065.2|PACid:23563902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]