SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.A02267.1|PACid:23564146 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.A02267.1|PACid:23564146
Domain Number 1 Region: 94-275
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6.54e-41
Family FAD-linked oxidases, N-terminal domain 0.039
Further Details:      
 
Weak hits

Sequence:  Eucgr.A02267.1|PACid:23564146
Domain Number - Region: 277-383,501-541
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00501
Family Hermes transposase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.A02267.1|PACid:23564146
Sequence length 595
Sequence
MLASLSLRRSLHSLRPRHRHLIVLSSSSAVPRAFCSDAAAAGTATTSSSSSEVRKYLGYT
ALVLFCGAATYYSFPFSDNAKHKKAQLFRYAPLPEDLHTVSNWSGTHEVQTRVFHQPESL
AQLEEVVREADAKRARIRPVGSGLSPNGIGLSRAGMVNLALMDRVLEVDKERKTVRVEAG
IRVQQLVDGIKEHGLTLQNFASIREQQIGGIVQVGAHGTGARLPPIDEQVTSMKLVTPAK
GTIEVSKEKDPELFYLARCGLGALGVVAEVTLQCVDRQELVEHTTVSTMQEIKKNHKKLL
SENKHVKYLYIPYTDTVVVVTCNPVSKWKSPPKFKPKYTVDEALQHVRQLYQESLQKYRP
EVKSSNDDEPDINELSFTELRDKLLALDPLNKDHVIKVNQAEADFWKKSEGYRVGWSDEI
LGFDCGGQQWVSETCFPAGTLSKPSMKDLEYIEELKRLIEKEDIPAPAPIEQRWTARSKS
PMSLASSPAEDDIFSWVGVIMYLPTSDARQRKEITEEFFHYRRLTQERLWDRYSAYEHWA
KIEVPKDNEELAALQARLRKRFPVDAYNKARRELDPNKILCNNKLEKLFPPSESP
Download sequence
Identical sequences A0A059DHN7
XP_010056286.1.83385 XP_018732452.1.83385 Eucgr.A02267.1|PACid:23564146 Eucgr.A02267.2|PACid:23564147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]