SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.B00726.1|PACid:23565863 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Eucgr.B00726.1|PACid:23565863
Domain Number - Region: 55-165
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000306
Family B3 DNA binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.B00726.1|PACid:23565863
Sequence length 183
Sequence
MEVDWSSFHVLAKTSHLVHEGLLSLYPTAQTRPTELPEIFWNKILEMHGQGVMLVLEKRL
CATDLKQRNGWLSIPRGQIRANFLTSGEIQALDNREDITISVIEPCLQVRHGLHLQKWNN
VRNHFSYVLTKEWTAVTHPIARNRLRKGGLVQLWSFRANGDLCFCLVNVEAPPAAVENMG
NQE
Download sequence
Identical sequences A0A059D0X8
Eucgr.B00726.1|PACid:23565863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]