SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.B01549.1|PACid:23566702 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Eucgr.B01549.1|PACid:23566702
Domain Number - Region: 346-377
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00341
Family Rho termination factor, N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.B01549.1|PACid:23566702
Sequence length 385
Sequence
MSSSVHLGRNVSGYVSSDGKRLPCSGFSGRGVSVSPCSSFAVSRGQFQIKLTSLKCSSNR
ASLLCKASNSGQKRNPDFSRHNRHGFSRGRNRQMEERDSFDNLDDSEMLSSKNGPLLSLS
SSPRSQATAVPGPREKEIVELFRKIQAQLRERAALKEEKKNEATKGQGKESETVDSLLKL
LRKHSVEQSKRKGFSNGSRDLTLEQPEQNVSSNEEKGSSFFDSNSILGDKSRDSNASLSR
PASKFQRQSPIPRVRYQSINFGDDSDDSTSVANLSGGKNKDYVEIHPEPLYEPAVNHEPE
LELEPEAETVILDGGVSDEGVDAESSDADEVDDNENMDQQGLVDEADLNALKLPELRALA
KSRGVKGFSKMKKSVLVELLSGRSG
Download sequence
Identical sequences A0A059D2L4
Eucgr.B01549.1|PACid:23566702 XP_010039265.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]