SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.B02480.1|PACid:23567635 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.B02480.1|PACid:23567635
Domain Number 1 Region: 162-286
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-45
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 667-748
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000203
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.B02480.1|PACid:23567635
Sequence length 797
Sequence
MEIDLNHAVSDVENASNACCDGHCEKGNGCLHCLSSTSSNSSSSSSSSAVPCSIYSELWH
ACAGRLTSLPKKGNVVLYFPQGHLEQVASASPYSPMEMPTFDLQPQIFCRVVNVQLLANK
DNDEVYTKVTLLPQLELVGLDSEGRALEELGVDENDIGGSPPRSTPHMFCKTLTASDTST
HGGFSVPRRAAEDCFPPLDYKQQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSV
FVSQKNLVSGDAVLFLRGEDGELRLGIRRAHRPRNVLPGSTVGEQNMCPAVLSAVASAVS
TKSVFHVFYSPRASHAEFVVPYQKYLKSINNVICIGTRFKMRVDVDDAPEKRCTGVVTRI
GDLDPYRWPNSKWRCLMVQWDDDITNGHQDRVSPWEIDPSVSHSPLSIQSSPRLKRPRTS
LPTMPPVPGGGVRLLDFEESLRSSKVLQGQEKLHLVSPVYGRDTLNCQVDFEQSPAHQGL
ASVVVEKANNINEYMRANAPSYAGFVESDRFPRVLQGQEICTLKSLTTKPEYNLGTWGKS
SLSCSSFGVHQAPKYHFDQVKSSESLQKVYFPYNDILKSSQDRTRCSDSTNFLREVASVR
SLRVQNEAIERTKVDVRNLESICTSPNFGDSQRAQANGSIDSLLSGCKLFGYPLTAEAPT
STLQNSGKRSCTKVHKQGNLVGRAIDLSRLNSYQDLLNDLERLFSMEGLLRDHDKGWRIL
YTDSENDVMVLGDIPWHEFCDVVTKIHIYTQEEVEKMTTGMISDDTQSCLDQAPLMMEAS
KSSSVGQPDGSPTVVRL
Download sequence
Identical sequences A0A059D541
XP_010043718.1.83385 Eucgr.B02480.1|PACid:23567635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]