SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.B03048.1|PACid:23568281 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.B03048.1|PACid:23568281
Domain Number 1 Region: 195-300
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-30
Family B3 DNA binding domain 0.00000802
Further Details:      
 
Domain Number 2 Region: 65-121
Classification Level Classification E-value
Superfamily DNA-binding domain 2.94e-17
Family GCC-box binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.B03048.1|PACid:23568281
Sequence length 364
Sequence
MDGNSSCIDELSSTSDSVCVPPPSKSSPPPLPPPPQSLCRHGSGTSVIVDSEGCVEAESR
KLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAAMAYDVAAQRFRGGDAVTNF
KRKSEAEDYDLEAAFLSAHSKPEIVDMLRKHTYRDELEQSKRKCLNSNGGGKRASMTEVL
GDLSSPGGIAMVRQLLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLRNGTSSATSKGVLLN
FEDSGGKVWRFRYSYWNSSQSYVLTRGWSRFVKEKGLTAGDIVSFHQSAGPEKQLHIGYR
RRSSLGGSGPVLPVQMVRLFGVNIFKVSAAGGGDDTGDWSGKRMREVELLSLGCNKKQMV
IGAL
Download sequence
Identical sequences A0A059D7A5
Eucgr.B03048.1|PACid:23568281 XP_010044293.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]