SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.B03849.1|PACid:23569269 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.B03849.1|PACid:23569269
Domain Number 1 Region: 39-149
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.84e-31
Family 2Fe-2S ferredoxin-related 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.B03849.1|PACid:23569269
Sequence length 150
Sequence
MSTVSLSSPCMVRVAPPKRINSAIIKNPFSLGSVNSVSKSFRLKSSPGFRASMAVYKIKL
IGPNGEENEFEAPDDTYILDSAENAGVELPYSCRAGACSTCAGQMVSGTVDQSDGSFLDE
NQMKEGYLLTCVSYPTSDCVIHTHKESELY
Download sequence
Identical sequences A0A059D9W0
XP_010045206.1.83385 Eucgr.B03849.1|PACid:23569269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]