SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.C00358.1|PACid:23569863 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.C00358.1|PACid:23569863
Domain Number 1 Region: 170-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-26
Family B3 DNA binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 48-106
Classification Level Classification E-value
Superfamily DNA-binding domain 3.53e-16
Family GCC-box binding domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.C00358.1|PACid:23569863
Sequence length 342
Sequence
MSMEEETLSVISNSDRNVLAEGSDSNDSALPSRLTTKRARQTPNGATSKFKGVVQQQNGH
WGAQIYANHQRIWLGTFKSDEEAAMAYDSAAIKLRSGDPHRNFPWSKLSVEELNFQSCYS
TEAVLTMIKDGTYQSKFTDFVRARTNGPHQEAGLDLVLAHPNGGLMCRQLFQKELTPSDV
GKLNRLVIPKKFAIKYLPRISGGSEAGKDDAPLQLRTLGLDDVQLVFYDRSMRSWKFRYC
YWSSSHSFVFTRGWNRFVKEKELRANDTVAFYMCEYREPRKEGRTFCMIDVQQRDKNGGG
LGEKGLGEEAKGSIEIMPVEGEKKDESKTMKKGLKIFGVEIC
Download sequence
Identical sequences A0A059CLZ1
XP_010047119.1.83385 XP_010047121.1.83385 Eucgr.C00358.1|PACid:23569863 Eucgr.C00358.2|PACid:23569864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]