SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.C00883.1|PACid:23570436 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.C00883.1|PACid:23570436
Domain Number 1 Region: 250-529
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 1.02e-81
Family Cytokinin dehydrogenase 1 0.00000103
Further Details:      
 
Domain Number 2 Region: 42-246
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.62e-38
Family FAD-linked oxidases, N-terminal domain 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.C00883.1|PACid:23570436
Sequence length 531
Sequence
MAGTYPMSSYFMGKFITTRSLSTVGKSKPRTQSLIPKLISKLCTDPESISMASTDFGNIV
WETPQGVLQPSCHEEIVDLVRNAYSDDNPSAPFPIAARGCGHSVRGQALAPGGIVVDMTS
LASHQGGTGGGPAVAVSWSRSLGHYADVSGGQIWRDVLEETLRHGLAPVSWTDYLYVTVG
GTLSNGGISGQTFRYGPQISNVYEMDIITGTEELMTCSPDKNPELFYSVLGGLGQFGIIT
RARIALDRAPKRVKWVRMLYSDFSAFTRDQEHLISKSGRDQDDALDYVEGLLLMHQGPPD
SWRSSFFPEPDHPRIASLMDRHELIYCLEVAKYYDDLTENTVNRDLENLFQELSHIPEFL
FQKDVTYIDFLDRVRKGELKLRAQGRWDAPHPWLNLFVPKSRISDFNNGVFKNIVLKRNI
TTGTVLIYPMNRNKWDDRMSTVVPDENVFYFVGFLHASGFDDWQEFDLQNEELLQFCEDA
CIEVKQYLPHFGSEREWMRHFGSKWRLFRERKAQFDPKMVFAPGQRIFDRD
Download sequence
Identical sequences A0A059CM33
Eucgr.C00883.1|PACid:23570436 XP_010047563.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]