SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.C02845.1|PACid:23572309 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.C02845.1|PACid:23572309
Domain Number 1 Region: 14-67
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0000000000000059
Family 2Fe-2S ferredoxin-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.C02845.1|PACid:23572309
Sequence length 84
Sequence
MNENKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKKKPESWRLAC
QTIIVGNKENSGKVVVQILPQWKK
Download sequence
Identical sequences A0A059CT03
Eucgr.C02845.1|PACid:23572309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]