SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.C02902.1|PACid:23572367 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.C02902.1|PACid:23572367
Domain Number 1 Region: 22-211
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 8.41e-30
Family FAD-linked oxidases, N-terminal domain 0.03
Further Details:      
 
Weak hits

Sequence:  Eucgr.C02902.1|PACid:23572367
Domain Number - Region: 371-501
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 0.0719
Family Vanillyl-alcohol oxidase-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.C02902.1|PACid:23572367
Sequence length 562
Sequence
MPPPSPVVCSGPDGGNGCILRNSYGAWNDRLDCRVQNVTYPSIEEEVRSAVAYAARHRLN
VKVVSKFSHTIPKLACPGRAGSAGSFLISTANYASGIDIDVTSLVVTADAGVPLRELIDR
VEGQGLSLVAVPYWEGVSVAGLISTGAHGSSWWGKGGAVHDHVVGISLVVPAKESEGFAK
VIRIEAQDQLLNAARVSLGMLGVISKVKFSLEKGFKRSITYDFTDDARIEEIYTDHAMKY
EFADITWYPSKHTAVYRNDNRVPLNTSGDGLYDFLGFQSNSVVVSKSVRATEKLLENARN
VDGKCALASTTVEYKKLIANGLRNGLIFTGYPVIGRQGKMQTSGSCLYSAPSRTDLTCAW
DPRIDGLFFYESTAIFPAQRFADFVRDVKKHRDMNPKNFCGVDIYNGFLVRFIKASKAYL
GQSEDSVVVDFNYYRADDPSTPRLNQDVWEEVEQMAFFKHGAKPHWAKNRNLAFLNVRNK
YPNFGKFMAAKKLLDPQNLFSSEWSDDILFRNEAAKGDGCALEGQCICSEDRHCSPAKGY
LCKAGLVYQEARVCRYTQSSMA
Download sequence
Identical sequences A0A059CT51
Eucgr.C02902.1|PACid:23572367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]