SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.C03157.1|PACid:23572607 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.C03157.1|PACid:23572607
Domain Number 1 Region: 234-515
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 3.71e-79
Family Cytokinin dehydrogenase 1 0.00000259
Further Details:      
 
Domain Number 2 Region: 31-232
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.87e-41
Family FAD-linked oxidases, N-terminal domain 0.00000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.C03157.1|PACid:23572607
Sequence length 534
Sequence
MMIAYAERFVHESDAEARQDDGVSGLDLQLQGILDWSPAAAAAAARDFGGLRSAKPRAVV
RPSGADDVARSVRAALRSPSLTVAARGNGHSINGQAMSDGGLVVDMRAAGAGHFQVVVGA
GAGAGGAHYAVVAGGALWDDVLERCLSYGLAPRSYTDYLGLTVGGTLSNAGVSGQAFRHG
PQTSNVTELEVVTGQGETLTCSRSDNSELFFAVLGGLGQFGIITKAKILLQPAPDMVRWI
RVVYADFGEFTRDAESLVTRPDGDTFDYIEGFAFVNSDDPVNGWPTVPLEPGQRFDPSRL
SPDAGSVLYCLELGLHHQRSNPPSDVDSVVGKLLGRLGFVEGLEFRRDVGYADFLLRVQN
AERDAKATGLWDAPHPWLNLFVSRNDIAEFDRVVFKGILKDGVGGPMLVYPMVRSRWDKR
TSVVLPESGEIFYLIALLRYTLPYPEGPSAKQLVSQNLEILKTCKENRIDYKLYLPYYQS
QEEWKWHFGKQWGRFVERKARFDPMAVLAPGQKIFSRSSVPGKIASDGGPAGLH
Download sequence
Identical sequences XP_010049279.1.83385 Eucgr.C03157.1|PACid:23572607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]