SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.D00269.1|PACid:23574035 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D00269.1|PACid:23574035
Domain Number 1 Region: 25-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.9e-24
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 192-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-21
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 3 Region: 330-427
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000373
Family B3 DNA binding domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D00269.1|PACid:23574035
Sequence length 438
Sequence
MGRRLRHRRRREGGGVEPEMDPGSPPSSPHFFKIVLSRALESGKLGIPKSFLRRYGKDLS
GLVLLKVPGGSTWPVKLEKSDDGKVWLWKGWRGFMEHYSIGHGHLLVFKYKGDSVFHVII
FDKSASEIDYPSSIESDMLSPEEEFLSRKEEDVVEIKDSEGSMPCSRPSSYRSSREYGVP
SLLAAFELASEFKSEHPFFKVVVQPTYVRKSLTIPREFFIKHVQKNKQIATLRYSDRSWQ
VKLRSHEHMACLSIGWSSFARETGLLLGDCCVFELIDRDDIVFRVSIFRSDGQILTEQSQ
CQEHPSESAFHASPCLSPVIAHERACQFESEYPFCNVVISPSHIKRQTVTIPWQFIRTYI
QKDHQMVNVVYLGQSFEVNLRVYQHLHIAILGVGWSALAREAHLRKGDVCMFELLDRDNI
VLRVSVFSSANKEVICIE
Download sequence
Identical sequences A0A059CCI6
Eucgr.D00269.1|PACid:23574035 XP_010052032.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]