SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.D00477.1|PACid:23574243 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D00477.1|PACid:23574243
Domain Number 1 Region: 218-249
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000628
Family Rho termination factor, N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D00477.1|PACid:23574243
Sequence length 253
Sequence
MDAVMLNLRSGVIVQFPASVASIKQQQLKVKTALFSPKENAHFTSVFRPRNEHTETSPNG
IRRSQSTKRDDAPEISPSSNENVSSVKQEEIISLFRRIQSSISNESVSTEKEGTDPNQDK
PAAESVLEIIRRSRKQAKEKVSLKGGNKQKPRRRSFPKKEEDEEHISSPVTDIKLTRPPS
NFVKKSPIPFPSAPKGKEGQWKEASPASAGSNDSTSRKIEEMKLQELKELAKSRGVRGYS
RLKKNELVELLRS
Download sequence
Identical sequences A0A059CCK0
Eucgr.D00477.1|PACid:23574243 XP_010052178.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]