SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.D01006.1|PACid:23574754 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D01006.1|PACid:23574754
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.26e-41
Family FAD-linked oxidases, N-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D01006.1|PACid:23574754
Sequence length 430
Sequence
MRTRSGGHDYEGLSYLSEVPFVIVDMANFRSISVDAEDKTAWVQSGATVGELYYRIAEKS
NTLGFPAGVCPTVGVGGHFSGGGYGTLLRKYGLAADNVIDVQLVDAQGRLLDRESMGEDL
FWAIRGGGGGSFGVVVSWKVKLVPVPSTVTVFTILRTLEQNATKLAHQWQLVANKFPNDL
FMRLTLQSNNSGPNGTRTMQAIFNTLYLAGVDSLLEVTRSRFPELNVTRQDCTEMSWIES
VLYFAGFPTGTPLEVLLNRSSNTKTFFKNKSDYVKEPIPESGLEGMWERFFEEDQGVPIM
EWNPYGGKMAEISESAIPFPHRAGVLYMIQHITIWTTGGNEVAPKHVSWIRSFYSYMAQY
VSKSPREAYINFRDLDIGMNNVIGDTSYKQASVWGKKYFKENFDRLVRVKTAVDPDNFFQ
HEQSIPPFSS
Download sequence
Identical sequences A0A059CDT2
Eucgr.D01006.1|PACid:23574754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]