SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.D01626.1|PACid:23575376 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D01626.1|PACid:23575376
Domain Number 1 Region: 77-259
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.94e-48
Family FAD-linked oxidases, N-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D01626.1|PACid:23575376
Sequence length 562
Sequence
MTPPPPSTPVSPLLLLLLFVLVSSSSASLYDTFLQCLLNHTQVLQQQQQQRQQEPSQILH
APTNSSFPTLLGSLIRNRRFGTSSTPKPLLILTPSQPSHVQSAVLCARRTGTEVRIRSGG
HDFEGTSYVSRAPFLILDMFNFRSVDVDVERETAWVGSGATVGELYYRIWEKSGLYGFNA
GVCPTVGVGGHLSGGGYGNMLRKYGLASDNVVDAQIVDVEGRVLDRSSMGEDLFWAIRGG
GGASFGVILGYRVKLVPVPNVVTVFRVAKTIEENATELVYQWQNIAPRTDNDLFMRLLLQ
PVSSKIQKGAKTVNASVLALFLGNADRLVSLISEEFPELGLKKEDCAEMSWIESALWWGD
FDSGVAVKALLDRMPKSVNFLKRKSDYVQQPMSREELELLWDRMIELGKVGFVFNPYGGK
MGEIPVSDAPFPHRAGNLFKIQYSISWSEDGIEAEQSYLAKIRELYNFMTPYVSKKPRRA
FLNYRDFDIGITDNGENSYREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNEQSIPVLP
RSSSAMSEYSGSTETTGKMTVL
Download sequence
Identical sequences A0A059CG80
Eucgr.D01626.1|PACid:23575376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]