SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.D01764.1|PACid:23575524 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D01764.1|PACid:23575524
Domain Number 1 Region: 104-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.36e-40
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 549-627
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000981
Family PB1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D01764.1|PACid:23575524
Sequence length 656
Sequence
MANRGGGEDDLYTELWKACAGPLVDVPRAGERVFYFPQGHMEQLEASTNQELNERIPLFN
LPPKILCRVMYIQLLAEQETDEVYAQITLLPEAPQSEPMSPDPYLPEPPRPRVHSFCKVL
TASDTSTHGGFSVLRKHATECLPPLDMNQSTPTQELAARDLHGYEWKFKHIFRGQPRRHL
LTTGWSTFVTSKRLVAGDSFVFLRGESGELRVGVRRMARQQSTMPASVISSQSMHLGVLA
TASHAVQTQTLFVVYYKPRTSQFIISLNKYLEAVNNKFSVGMRFKMRFEGEDSPERRFSG
TIVGVEDISSQWTDSKWRSLKVQWDEHASVPRPDRVSPWEIESSVPSIPPSMTESAVAKK
RPRPPAELPALDTAGATLHDVGLMQSCDSTQPTVFIEGKRSDNHGIWHHKQTSVNTGSNS
ISWPQTEGDRQFSPSVCGWPLLSSSTMHSPKPRNEPKVELAEKPERPTSCRLFGIDLINH
SSNSQQVDRLTVQPLDGSAGINETHTPGNAPAADSQQKSVVLKTSKEIIPKQSVVSPKEI
RSKQSCSTTARSRIKVQMQGVAVGRAVDLTMFEEYDQLIDELEEMFEIKGELRPRNKWEI
VFTDDEGDMMLVGDDPWPEFCNMARRIFIWSSQDVKKMSPGSRLPVSSVEEEGSLA
Download sequence
Identical sequences A0A059CGC6
Eucgr.D01764.1|PACid:23575524 XP_010053162.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]