SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.D02649.1|PACid:23576599 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D02649.1|PACid:23576599
Domain Number 1 Region: 28-215
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.94e-34
Family FAD-linked oxidases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D02649.1|PACid:23576599
Sequence length 567
Sequence
MSVSATPPADPIRCTSSGCTITNSYGAFPDRSTCKAGAVAYPTSEEELVWVVGNATKSKR
KMKVVTRFSHSIPKLVCPDGEEGLLVSTKYMTRIVRVDQEGMRMSVEGGVTLRQLIEEAA
KVGMALPYAPYWWGLTIGGMLGTGAHGSSLWGKGSALHDYVEAMRIVIPGGPGDGYARIR
TLDVNTKSTHAEMNAVKVSLGVLGVIAQVTLKLQPLFKRSLTYSIKGDSNLGEQSANFGN
LHEFADIIWYPSQQKVVYRIDNRTTLDASGNGLYDFIPFRATSSLTLALVRSTEELQESI
NNADGKCNGAKLISSTLETDAYGLTNNGIIFSGYPVIGYHNRLQSSGTCLDSPHDGLTTA
CPWDPRVKGEFFHQTTFSIGLSMVRSFIEDIQQLVTLEPKALCGVELYNGILMRYVKASS
AYLGKQEDGIDFDITYYRSKDPLSPRLYQDVLEEIEQMALFKYGALPHWGKNRNLAFDGA
IKRYKKAQEFLKVKETYDPLGLFSSEWTDQVLGLKEGVSIVKDGCALEGLCICSQDAHCA
PNKGYYCKPGKVYKEARVCTRTSVKAQ
Download sequence
Identical sequences A0A059CJ97
Eucgr.D02649.1|PACid:23576599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]