SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.E01947.1|PACid:23578601 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.E01947.1|PACid:23578601
Domain Number 1 Region: 30-143
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-17
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.E01947.1|PACid:23578601
Sequence length 148
Sequence
MKTPESSTSDVAHCVCAERVDVSTELVLQNDPWMIMKELTESDLSHLSWLLLPGGCLKTH
VFPQMDEEMLRKVKSKEGMQVVGIDVDTGWKHWFVFRCWGSSGSYVLNGGWTKEFVEKKR
LKVGDEIGMVWFMSSRMFYFKVLHRAAA
Download sequence
Identical sequences A0A059C5N5
Eucgr.E01947.1|PACid:23578601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]