SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.E02045.1|PACid:23578664 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.E02045.1|PACid:23578664
Domain Number 1 Region: 76-185
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000314
Family B3 DNA binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.E02045.1|PACid:23578664
Sequence length 189
Sequence
MATKGPENTKEVGDPHQEIVPAQPKRKSMVSLTNAEAFIAEKKAKSKRTQKGKKEASGCD
PEEVSTELTLLFDPYKIKKRLTQSDLSHLSRFLIGRDFVKSHFLRWMSEEMVRQVESGKG
ADVIVRDMDTCSEHRLVFVFWASSGCYVLKGGWIKEFVKRRGLAVGDEVGMYWEPSASKF
HFSLLHKAN
Download sequence
Identical sequences A0A059C4Z4
Eucgr.E02045.1|PACid:23578664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]