SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.E02114.1|PACid:23578703 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.E02114.1|PACid:23578703
Domain Number 1 Region: 77-174
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000549
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.E02114.1|PACid:23578703
Sequence length 177
Sequence
MPDPMTGFLDTKELGAALARPERKSTASLIDDRTLIVEKKAKHCRSQTEKKGASECEVEE
ERRGGVSTELVLRYDPYKIKKTLKKSDLDHLSRLMIPWAVVATHSSEGANIVVWDADTRS
EQQLVFAYWASSRSYVLKGCWMKVFVQRRGLAEGDKIGIYWDPIASKFHFSLLCKAN
Download sequence
Identical sequences A0A059C5D2
Eucgr.E02114.1|PACid:23578703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]