SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.E03465.1|PACid:23579814 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.E03465.1|PACid:23579814
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-16
Family B3 DNA binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.E03465.1|PACid:23579814
Sequence length 542
Sequence
MLSASDAGKIGRLVLPKKCAEAYFPSISQPEGLPLKVQDAKGSEWIFQFRFWPNNNSRMY
VLEGVTPCIQSMQLQAGDIVTFSRLEPEGKLVMGFRKASTAPPSDQENETAKSNSGITVQ
DAELADPSSWSKVDKSGYIAKEVLGAKSALPRKRKSSTLGSKSKRLRIENEDVIELKLTW
EEAQGLLRPPPPPNHIPSVVVIEGFEFEEYEDAPVLGKPTVFRTDTVGKKIQWAQCEDCL
KWRKLPADALLPSKWTCADNSWDPERSSCSADQDLTAEELEDMLSNNNPAPSKKAKAPKQ
ENMEALEGLDTLANLAILGEGEVLPSSSSSSQATTKHPRHRPGCSCIVCIQPPSGKGPKH
KPTCTCNVCLTVKRRFRTLMLRREKKQSEKEGEGSRKKLQHQNLSLAEKSPEDDPSQCNN
NIANGSPSQKKVGNDGSDDEMNRVKSSGSPFKGQIDLNIQPEREEELSPGSDSGGMVKLQ
HVAPQKYPRQRVLTQDSFRNSTGDPAVVDLDGGERLVSDTVESGQQEVNEERAKALASTV
HK
Download sequence
Identical sequences Eucgr.E03465.1|PACid:23579814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]