SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.E04270.1|PACid:23580536 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.E04270.1|PACid:23580536
Domain Number 1 Region: 4-84
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000134
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.E04270.1|PACid:23580536
Sequence length 164
Sequence
MHPSQPLLIAAGFGIVELVTELVRSNPDLIWTVDEQSHNIFHVAVMYRREKIFDVIHDLG
AHKNMITTYKDPDNNNNLLHLAGKLAPLDQLNSVSGAALQMQRELLWFKESFSLCNPQFI
EMVDNVPILQIDMVWCYFVVQDISSLSLAGIQLQKAREGIERAH
Download sequence
Identical sequences A0A059CAN5
Eucgr.E04270.1|PACid:23580536 Eucgr.E04270.2|PACid:23580537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]