SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.F00044.2|PACid:23580710 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F00044.2|PACid:23580710
Domain Number 1 Region: 248-344
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.55e-16
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 37-93
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000471
Family B3 DNA binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F00044.2|PACid:23580710
Sequence length 360
Sequence
MEGTCKECKSWEEEIYWTHFHSIHFCQFLQGDFHQQLGPSGATWKVGTVADDENLLFKHG
WQDFVKDHALEKNDILVFRYNGESSFNVLVFNQHSLCEKEAAYFHKRCSHNPADRECGTK
RKLGDSSVEAMHTPVSHDVKRTLTEDPREDRTVTVADRNILSQAKASENLIEAGASGKPR
NKKATPKKKLSVAFDCLEEKPAAQDSTPKSLFIGSRGSPVYVSNRRPVTEEEESSAFKLA
RAAASSDSFLVVMRPTHVYKRFYLSIPTDWATTHMDRRNQDVILRVGEGTWHARYRLTGR
GSGGLSSGWKNFTLENNLEQSDVCVFNLADSISKNIILDVTIFRVVEDIVPPTLVNSFSV
Download sequence
Identical sequences A0A059BJJ9
Eucgr.F00044.2|PACid:23580710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]