SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.F02704.3|PACid:23583575 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F02704.3|PACid:23583575
Domain Number 1 Region: 246-350
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-19
Family B3 DNA binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  Eucgr.F02704.3|PACid:23583575
Domain Number - Region: 89-162
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.0693
Family Anthrax protective antigen 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F02704.3|PACid:23583575
Sequence length 845
Sequence
MLLELLDCGGINCATCAKSSGLLPIASDERPSEFGMINVRTGELQSSTTDNHFDSDEVDK
LKLIRLRSSTDDSGLGQSLLTQYNDTNRSHEPTNREGVINTPSALEMGGSCYLLSSKASN
GATHASQPDILKANIAAKEFDDPHARTDLSMTIGVPLGKSYPSLRDHSTTPSLSPQGPKS
RHVLHKPPKPAFASGFESNASVVSQIRVARPPAEGRGRNQLLPRYWPRITDQELQQISGD
SNSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGLPLRIQDVKGKEWVFQF
RFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRMDPEAKLIMGFRKASTSMMQDSQLA
AVSNGNHSSEALISGGFENVPMISGYSSLLHSFKGSTDPQLNALSKHWSSASGDISWQGT
EKHGLPRDAFLLPGMSAPERKRARNIGSKSKRLLIDSQDALELKMTWEELQDLLRPPSVN
PSIVTVEDHEFEEYDEPPVFGKSSIFILRSTGGQEQWVQCDSCGKWRRLPVDVLLPPRWT
CAENAWDQSRRLCSAPDGLTPRDLENLLRLTKEFKKRKLATTVRPALEHESSGLDALANA
AIVGDDGDPGTTSVAATTKHPRHRPGCSCIVCIQPPSGKGKHKPTCNCNVCMTVKRRFKT
LMMRKKKRQSEREAEIAQRKQLWGSKDEIEVDSTSAHRSSHHNPSENESRIGNELESQSQ
TTNSANTFAETGKGQINLNCQLDLNCQPDRNEDLKLGSSQTSMMNLLRVASQPLETYLKQ
NGLASLVSEQQASPAGHVQLQGATTDNEGQPSEDHCADSEIQEMALEKDDTDEKDSTPDQ
GEGDP
Download sequence
Identical sequences A0A059BTA4
Eucgr.F02704.3|PACid:23583575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]