SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.F03055.2|PACid:23584032 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F03055.2|PACid:23584032
Domain Number 1 Region: 86-172
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000000191
Family 2Fe-2S ferredoxin-related 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F03055.2|PACid:23584032
Sequence length 196
Sequence
MGSLQLNSSHLASFSLTPSFSHRSRTRRAHLRPFRSQTSFARSRIRAVGTVPESGSETAA
PEEPPCVNFAFVSSVLLPDGTPDVHLRTACGGQKLRDIMLDSDVELYGPYARPLLNCAGG
GTCATCLVEVVQGKELLSPLTDKEKEKLKKKPKNYRLACQTTVGKPDSRGLVVIQQLPEW
KAHEWKFEKVSPSESL
Download sequence
Identical sequences A0A059BU56
Eucgr.F03055.2|PACid:23584032 XP_010062509.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]