SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.F03700.2|PACid:23584858 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F03700.2|PACid:23584858
Domain Number 1 Region: 342-481
Classification Level Classification E-value
Superfamily CBS-domain pair 1.39e-33
Family CBS-domain pair 0.0024
Further Details:      
 
Domain Number 2 Region: 497-560,589-612
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.000000000000101
Family CorC/HlyC domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F03700.2|PACid:23584858
Sequence length 670
Sequence
MAIESLIYTRPAFVSGAKSPFLVVCDRRRRLPARVFPRGYQHSSRFAVNCAGPSTSAGCY
DAGFQNNLVFRNEVPLRSVLVRSSENLANCSVSSADAVEVAVRRGVVLVAMLCGVLFLGC
RRVFAVESAVNAGYGVIGQSILLLRNAWPKVSQVLIVFKEQGLVLALLFGLSAFFSMAET
SITTLWPWKVRELAEKEPENGVFRMLRSDVTRFLTTILIGTTVVNIGATALVTDAATAMF
GEAGVSAATGVMTVAILLLTEITPKSIAVHNATEVARFVVRPVAWLSLVLYPVGRIVTYL
SMGMLKMLGLKGRSEPYVTEEELKLMLRGAILSGAIEEEEQDMIENVLEIKDTHVREVMT
PLVDVVAIDASATLIDFHRLWVTHQYSRVPVFEQRVDNIVGIAYAMDLLDFVQKGGLLES
STVGEMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEEIVGE
IFDENDSKVKIQKKTGYIVMRAEGVYDVDANTSIDQLSEDLNIKMPEGHQYETVSGFVCE
AFGYIPRTGETIKVILEKENREEEDEYMEDESDRKDQKDQKEKEKHQFFKLEILEGNARK
VSAVRFDRINSDDAAALETKVTRLVPKIMKRRSSSDDESDWDKNDEDPFPLGEWSLQSSS
EGSQDTISEQ
Download sequence
Identical sequences A0A059BXX2
Eucgr.F03700.2|PACid:23584858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]