SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.F03833.1|PACid:23585024 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F03833.1|PACid:23585024
Domain Number 1 Region: 76-299,420-467
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.32e-72
Family Tandem AAA-ATPase domain 0.000000379
Further Details:      
 
Domain Number 2 Region: 469-577,673-756
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-41
Family Tandem AAA-ATPase domain 0.0000428
Further Details:      
 
Domain Number 3 Region: 298-419
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 7.59e-37
Family Pre-protein crosslinking domain of SecA 0.0000755
Further Details:      
 
Domain Number 4 Region: 953-1056
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 3.27e-20
Family Helical scaffold and wing domains of SecA 0.0013
Further Details:      
 
Domain Number 5 Region: 779-888
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.44e-18
Family Helical scaffold and wing domains of SecA 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F03833.1|PACid:23585024
Sequence length 1061
Sequence
MATVPALVQLHTVSSNPPPPQQHPLHFLKPTSSFPCSASPSPSLPSSHGLRRRRLTRVSA
VAAVKENNGRVARTWRDFASLNYWVVRDYYRLVESVNYLEPQMQRLTDDQLAAKTLEFRR
RLGQGETLADIQSEAFAVVREAAKRKLGMRHFDVQIIGGAVLHDGSIAEMKTGEGKTLVS
TLAAYLNALTGEGVHVVTVNDYLAQRDAEWMGRVHRFLGLSVGLIQKGMKSAERRRNYQF
DITYTNNSELGFDYLRDNLAGNSEHLVMRWPKPFHFAIVDEVDSVLIDEGRNPLLISGEA
SEDAARYPVAAKVADLLVQGVHYKVELKDNSVELTEEGIELAELALETNDLWDERDPWAR
FVMNALKAKEFYRRDVQYIVRNGKALIINELTGRVEEKRRWSEGIHQAVEAKEGLKIQAD
SVVVAQITYQSLFKLYPKLSGMTGTAKTEEKEFLKMFHTPVVEVPTNLPNIRKDLPIQAF
ATARGKWQYAREEVEYMFRQGRPVLVGTTSVKNSEHLSDLLKEWKIPHNVLNARPKYAAR
EAEIVAQAGRKYAVTISTNMAGRGTDIILGGNPKMLAKEIVEDSLLSFLTQEVSELEADR
DILPEKVLSKIKVGPSSLALLAKTALMAKYVRKSEGKYWTLKEARSIISESVEISQSTDI
KELHRLVNEQAEMYPLGPTIAIAYLEVLKDCEVHCLNEGAEVKRLGGLHVIGTSLHESRR
IDNQLRGRAGRQGDPGSTRFMVSLQDEMFQKFNFDTEWAVRLISKITNDEDIPIEGDAIV
KQLLALQINAEKYFFGIRKSLVEFDEVLEVQRKHVYDLRQLMLMGDSESCSQHIYQYMQA
VVDEIVISNVNPAKHPSTWSLNKLLEELFSISGKLLDGLFSGITEEALLEPLTHLDDINS
VDISNFNLPNLPKPPNTFRGIHMKSASLKRWLVICSDDMAKNGRYRSAICLLRKYLGDLL
IASYLDAVQESGYDYAYVKEIERAVLVKTLDCFWRDHLVNMNRLSSAVNVRSFGHRNPLE
EYKIDGCRFFISMLSATRRLTVESLTRYWSSPLETQEIYMS
Download sequence
Identical sequences A0A059BX03
Eucgr.F03833.1|PACid:23585024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]