SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.F03905.1|PACid:23585101 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F03905.1|PACid:23585101
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.09e-29
Family N-terminal domain of MutM-like DNA repair proteins 0.00094
Further Details:      
 
Domain Number 2 Region: 146-233
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.07e-26
Family Middle domain of MutM-like DNA repair proteins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F03905.1|PACid:23585101
Sequence length 411
Sequence
MPELPEVEAARRAVEDHCVGRKIKRAVVADDPKVIDGVSPADFQSALVGKTVVAARRKGK
SMWLQLDSPPFPSFQFGMAGTVYIKGVAVTKYKRSAVKDTDEWPSKYSKVFIELENGLEL
SFTDKRRFARVRLLNDPTSVPPISELGPDALLEPMTIDEFAESVRKKKIAIKTLLLDQSF
IAGIGNWVADEVLYQAKIHPLEPASSLSKESCATLHKCIKEVIEKAIEVGADSSQYPSNW
IFHSREKKPGKAFVDGKRIDFITAGGRTTAYVPDLQKLNGANVLNAANKKGKQTSKRKKR
GKEEEEEDEDDDGGVAIEEDKEDKETAKLKKANKPRGQGGKSSTRRKPKESDDESDEADI
GEEDESAYGNGKNEQKKRTRGAVKNEKGPEKAANRKAQPARNSQKPKKRAK
Download sequence
Identical sequences A0A059BX90
XP_010063494.1.83385 Eucgr.F03905.1|PACid:23585101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]