SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.F04104.1|PACid:23585357 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F04104.1|PACid:23585357
Domain Number 1 Region: 37-234
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.54e-45
Family FAD-linked oxidases, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F04104.1|PACid:23585357
Sequence length 493
Sequence
MSLSAPALCSSADSIASCLTQHNVNNFTTFPATENESARYYELLNSSIHNLRFSGPAVPK
PVAIIFPGSVEQLKSSIVCCREGAWEIRVRSGGHSYEGTSWVATDGAPFVVVDMMNLNGV
RVDLDTMTAWVEGGATLGETYYAIAEASDVHGFSAGSCPTVGVGGHISGGGFGLLSRKYG
LAADNVVDALLVDSRGRLLDRKAMGEDVFWAIRGGGGGLWGIIYAWKIKLLNVPRKVTGF
IMRTIGISATFKGFFLGPRTEAVSLLNRKFPELGIEEEDCKEMSWIESILFFSGLGDGST
ILDLKNRFIDYKYYKAKSDYVRSPISLSGILEALDILEAEPKGYVILDPYGGIMHKISGE
SIAFPHREGNLFTIQYLVEWHENDNEVRDGYLNWIRGFHDSMAAHVSSGPRAAYVNYMDL
DLGVTGLIDPSAGKDDAVEIARAWGEKYFLGNYERLVRAKTKIDPLNVFRNQQGIPPMPP
GGGARAGRLDAAK
Download sequence
Identical sequences A0A059BXQ9
Eucgr.F04104.1|PACid:23585357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]