SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.G00076.2|PACid:23585849 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G00076.2|PACid:23585849
Domain Number 1 Region: 117-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-43
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 552-626
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000517
Family PB1 domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G00076.2|PACid:23585849
Sequence length 671
Sequence
MASHPSNHSCGRPHQGAFADALYKELWHACAGPLVTLPREGERVYYFPQGHMEQLEASTN
RGLEQQMPSFDLPSKILCRVVNIQLRAEPETDEVYSQITLLPEPEQKEVTSPDPPLPEPP
RCKVHSFCKTLTASDTSTHGGFSVLRRHAEECLPLLDMTQQPPWQELVATDLHGNEWHFR
HIFRGQPRRHLLTTGWSVFVSSKKLIAGDAFIFLRGEDGELRVGVRRLMRQQSNMPSSVI
SSHSMHLGVLATASHAIATGTLFSVFYKPRTSRSEFIVSLNKYLEARAHKLSIGMRFKMK
FEGEEVSERRFSGTIIGVGDSMSSGWTNSEWRSLKVQWDEPSSIMRPDRVSSWELEPLVV
TAPSNSQQVQRKRARPTVLPSSSVQELSVFGGPKAPEYSSDFLHGDSQRGRDVYLSPKFS
PSARSKSLNYNGNGSPAALSGYTVNWPSHMETITDPCTPVNGKESSEKRESGGSGCRLFG
VQLLDSAKKESLSVTLAAGQRDDDKTALSVDDDSKEHQEPSCVNHFDNPSACYDPEKSCP
NSSQDLQSRQIRTCIKVHMQGIAVGRAVNLAQFNRYEDLLMRFEEMFEIGGELCGSMRKW
QVVYTDDEDDMMMVGDDPWNMAKKIYIYTTEEVKRLLPKIKLPVEDVGPANGGSDVAVNT
DDRSSVVGSGC
Download sequence
Identical sequences A0A059B8M4
Eucgr.G00076.2|PACid:23585849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]