SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.G00076.3|PACid:23585850 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G00076.3|PACid:23585850
Domain Number 1 Region: 117-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-43
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 526-604
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000569
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G00076.3|PACid:23585850
Sequence length 649
Sequence
MASHPSNHSCGRPHQGAFADALYKELWHACAGPLVTLPREGERVYYFPQGHMEQLEASTN
RGLEQQMPSFDLPSKILCRVVNIQLRAEPETDEVYSQITLLPEPEQKEVTSPDPPLPEPP
RCKVHSFCKTLTASDTSTHGGFSVLRRHAEECLPLLDMTQQPPWQELVATDLHGNEWHFR
HIFRGQPRRHLLTTGWSVFVSSKKLIAGDAFIFLRGEDGELRVGVRRLMRQQSNMPSSVI
SSHSMHLGVLATASHAIATGTLFSVFYKPRTSRSEFIVSLNKYLEARAHKLSIGMRFKMK
FEGEEVSERRFSGTIIGVGDSMSSGWTNSEWRSLKVQWDEPSSIMRPDRVSSWELEPLVV
TAPSNSQQVQRKRARPTVLPSSSVQELSVFGGPKAPEYSSDFLHGDSQRGRDVYLSPKFS
PSARSKSLNYNGNGSPAALSGYTVNWPSHMETITDPCTPVNGKESSEKRESGGQRDDDKT
ALSVDDDSKEHQEPSCVNHFDNPSACYDPEKSCPNSSQDLQSRQIRTCIKVHMQGIAVGR
AVNLAQFNRYEDLLMRFEEMFEIGGELCGSMRKWQVVYTDDEDDMMMVGDDPWNEFCSMA
KKIYIYTTEEVKRLLPKIKLPVEDVGPANGGSDVAVNTDDRSSVVGSGC
Download sequence
Identical sequences A0A059B8Y5
Eucgr.G00076.3|PACid:23585850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]