SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.G00679.1|PACid:23586332 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Eucgr.G00679.1|PACid:23586332
Domain Number - Region: 58-92
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00824
Family B3 DNA binding domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G00679.1|PACid:23586332
Sequence length 97
Sequence
MKHQELPGLQAAKLHLAERSQVDSTRRCRCRCRRRRRWHNQVSRPLTSSKMKKITLSPRI
WILQIGLPKRFMRKYGENLSKRMLLRVSNGAIHWPME
Download sequence
Identical sequences A0A059BAM4
Eucgr.G00679.1|PACid:23586332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]