SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.G00888.1|PACid:23586514 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G00888.1|PACid:23586514
Domain Number 1 Region: 25-122
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.04e-22
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 219-318
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-21
Family B3 DNA binding domain 0.0047
Further Details:      
 
Domain Number 3 Region: 355-454
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-19
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G00888.1|PACid:23586514
Sequence length 463
Sequence
MASGRRRRREDGGVDPDTATGPRLESPHFFKIILSDTLESGKLGIPKKFLRRYGKDLSSL
VLLEVLGNSTWSMGVEKLNDGTVWLWKGWQEFMQHYSIGPGHLVVFKYKGNSTFRVMIFD
RSASEIDYSLSSISNLGSGFISPKRENVIEVEDSEDFAPCQEKRVDPHSSCSQPSPSCSS
PDLEEGIGQSRCRASHPEPNFGGPMSSWPLRSFELACEFDSEYPFFKVVIRPSYIEHHVV
NVPRWFIRQHIQQIKEIVTLRHSNRTWPVKLRTYPSGSMQFSSGWIAFVRGTHLRVGNVC
VFELIDRDDIVFRVYIFSSAGRNNESKCRMNRSEPVFCDPTPSRPLTTPELAGEFDSEHP
FFELVIQQSHFRKMHVPGQFVRQHIQEHKKEGTLRYSDRSWPVKLSRYTRGMRVFFSAGW
RAFARETHLCEGNVCVFELIDRDDVVFKVSIFSSGGKDHIHID
Download sequence
Identical sequences A0A059BAW7
XP_010065663.1.83385 Eucgr.G00888.1|PACid:23586514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]