SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.G00890.1|PACid:23586517 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G00890.1|PACid:23586517
Domain Number 1 Region: 31-130
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-23
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 451-552
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-22
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 3 Region: 336-437
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-21
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 4 Region: 200-293
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.26e-21
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 5 Region: 589-687
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-19
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G00890.1|PACid:23586517
Sequence length 698
Sequence
MARRRRHHRRGHRRRRVEDEGAEQEATPATPPSCPHFFKIILSQTLESGKLGIPKRFLRR
HGKDLLGLVFLKVEGGLTWPVKLEKSEDGMVWLWKGWRKFMEHYSIGFGHLLVFRYEGDS
VFRVIIFDKSASEIDYPSSIGSYGPRPEGEFLSRKEEDVVEIEDSEGFAPRSRPRSKGLS
RGFGGRSSLTALELASKFKSDHPFFRVVMRPSYIQKYLCVPCEFFRKHVQKNKQLVTLRY
SDRSWQVKLRSYGHRRMAFLSTGWSSFVRETGLHVSDVCVFELIDRNDIMFRVSNFNNDG
WIEIGQSQCQESSSEPSFHGSPCLSPVTAHEKASGFESDHPFFKVVMRPSYVRKQLSIPS
GFFRKHVQKNKQIATLRYSDRLWQVKLRSFEHRGTAFLSNGWCSFVRETGLRLRDVCVFE
LIDRDDIVFSVYIFKSDGLSPVSAFEKARRLESDHPFFKVVMRPSYVRKRLSIPSEFFRK
HVKKNKQVATLSYLDRSWQVKLKSYDHRGMAFLTSGWPSFTRETGLRLGDVCVFELIDRD
DIVFRVSIFSSDGRIEIEQSQFRESSSEPAFHGSPCPSPVATYEKASKFESEYPFFHVVI
LPNHIYTKLNIPWKFMKTYIRGDRRMVTLVNSGRSWEVKLHGYKRFQIAFLAAGWSAFVR
EARLCIGDACVFELIDRDNIVFRISIFSGVNREVICID
Download sequence
Identical sequences A0A059BBI7
Eucgr.G00890.1|PACid:23586517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]