SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.G01238.1|PACid:23586853 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G01238.1|PACid:23586853
Domain Number 1 Region: 374-474
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-17
Family B3 DNA binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 31-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-16
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 3 Region: 236-336
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000392
Family B3 DNA binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G01238.1|PACid:23586853
Sequence length 507
Sequence
MASCSGHRRRRREGGAVEREAVTGPPRRGSRCFFKFILSGALDSGSSCGKDLSNSVLLKV
PDGSTWTIELEKRNHDMVLLGKGWREFMEHYSIGHGHFIVFKYKENSTFRVIIFDKSASE
MDYSSSRGETSYLGSELPSPEAEDVVETDRLEDVKPRQRMRMEPHLPCSQLSPSFSPRGS
EVSMDTDPEEPHLAQAQAGLTERSKQPTCGASHSELDFHGPMLPRPLTTPELTRKINSKY
PFFIKVIRRSYMSKLSIPGGFIKQHKLEKQRATLRHANRSWSVRLGGSNRHVRGALCLFF
SAGRDAFARETHLHVGHVCMFKLIDRDDIVFEVSILSVLRGNKLSKRRVNHHELGIRGPT
PPKPPTTPEVASEFESEHPFFKVVIQQYHMKQMYVPNQFSQQHIQENKEMATLRFSDRSW
LVKLLSYTHNKYQGVYFSVGWKEFARETHLCVGNICMFELIDSDDVVFQVSVFSSAGGTE
KSTCRASRSELDFHGPALSRPLTLPEF
Download sequence
Identical sequences A0A059BCJ6
Eucgr.G01238.1|PACid:23586853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]