SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.G01947.1|PACid:23587522 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Eucgr.G01947.1|PACid:23587522
Domain Number - Region: 342-373
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00333
Family Rho termination factor, N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G01947.1|PACid:23587522
Sequence length 381
Sequence
MSILYFLAGYVSSDGKRLPCSGFSGRGVSISPCSSFAVSRGRFQIKLTSLKCSSNRASFL
CKASNSGQKRNPDFSRHNRHGFSRGRNRQTEERDSFDNLDDSEMLSSKNGPLLSLSSSPR
SQATAVPGPREKEIVELFRKIQAQLRERAALKEEKKNEATKGQGKESETVDSLLKLLRKH
SVEQSKRKGFSNGSRDLTLEQPEQNVSSNEEKGSSFFDSNSILGDKSRDSNASLSRPASK
FQRQSPIPRVRYQSINFGDDSDDSTSVANLSGGKNEDYVEIHPEPLYEPAVNHEPELELE
PEAETVILDGGVSDEGVDAESSDADEVDDNENMDQQGLVDEADLNALKLPELRALAKSRG
VKGFSKMKKSVLVELLSGRSG
Download sequence
Identical sequences A0A059BDM5
Eucgr.G01947.1|PACid:23587522 XP_010066423.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]