SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.H00815.1|PACid:23590199 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H00815.1|PACid:23590199
Domain Number 1 Region: 584-658
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000155
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H00815.1|PACid:23590199
Sequence length 695
Sequence
MEAEQVVANSGDPGREMWLDKQEEEEENLLNANEAASVFYSDFPLPDFPCMSSSSSSSST
RAPVKATTCSSSSSSSASSSSSAASWAVLRSEDTAAENMENRKNSRRSDYCDDNSNHIFQ
HAREADAPSRALSSTASMEIILENPVDQASTDAVGSCIDAIDTFGYMDLLENNDFFDPAS
LFQSELLLEEEFQNQEPEAQLAEQQNQRAQATSAEADSGNRTGPVSDEMGAVLLEWLTEN
KDDISPDDLRRIKIKKATVETAAKRLGGGREAMKQLLKLILQWVQTNHLHKKRLKEAASV
SASVSASQVPYQYQEPFHHHQNPNPNLSFSPEPNGLHPQSFPHQPQWIPPPPPYVACPTP
MMEVPPPPPGYCPAPGYMGDPAYSHGAPPDHLSGNPFPPEYQMINSAQSWPMSQFSMAAQ
PYDYPENFHPPPQAQGLRGYQHHQYPFQYYNGHGQRLIRLGSSATKEARKKRMARQRRFL
SHHRSSHHHHQQSNQQGNHQSMAVAAEQHARLGGENCAIPEAAHQAHNHPGSWVYWPSPA
HAGQVAVPPSLPAMDPVQVAHPADQPAMQQQNYQRQVAPERRQKEAETHLPELEARDGIS
IAMEDIGTSKVWNMRYRFWPNNKSRMYLLENTGDFVRANGLEEGDFIVIYSDVKCGKYLI
RGVKVRQPEGTKPEAHKRPEKSQRSAHASSSQKKQ
Download sequence
Identical sequences A0A059AXC8
Eucgr.H00815.1|PACid:23590199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]