SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.H01489.2|PACid:23590952 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H01489.2|PACid:23590952
Domain Number 1 Region: 42-96
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0000000000192
Family Ribosomal protein L9 N-domain 0.0019
Further Details:      
 
Domain Number 2 Region: 112-200
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 0.000000903
Family Ribosomal protein L9 C-domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H01489.2|PACid:23590952
Sequence length 218
Sequence
MSSIRCGRNAIRQIVRGASVRGSDGGVHPLFHACQGVRYRKLEVILTTSIEKLGKAGETV
KVAPGYFRNHLMPKLLAVPNIEKFAYLIREQRKIYQPQEVEEVKVVTETVEDKMKEYEAA
AKRLDNALLVLRRFINVEKLRARATKDEPIELKSPVMKEEIVSEVARQLCVQIDPEHLHL
PNPLTNVGEYEVPLRLPKSIPLPEGKIQWTLNVKVRCK
Download sequence
Identical sequences A0A059AYB5
XP_010070225.1.83385 Eucgr.H01489.1|PACid:23590951 Eucgr.H01489.2|PACid:23590952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]