SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.H01489.3|PACid:23590953 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H01489.3|PACid:23590953
Domain Number 1 Region: 42-96
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0000000000148
Family Ribosomal protein L9 N-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H01489.3|PACid:23590953
Sequence length 188
Sequence
MSSIRCGRNAIRQIVRGASVRGSDGGVHPLFHACQGVRYRKLEVILTTSIEKLGKAGETV
KVAPGYFRNHLMPKLLAVPNIEKFAYLIREQRKIYQPQEVEEVKVVTETVEDKMKEYEAA
AKRLDNALLVLRRFINVEKLRARATKDEPIELKSPVMKEEIVSEGNAEMTLETILLMLFD
HILCCRVQ
Download sequence
Identical sequences A0A059AYM8
Eucgr.H01489.3|PACid:23590953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]